Eumetopias jubatus (Steller sea lion): 114202043
Help
Entry
114202043 CDS
T07240
Symbol
GOT2
Name
(RefSeq) aspartate aminotransferase, mitochondrial
KO
K14455
aspartate aminotransferase, mitochondrial [EC:
2.6.1.1
]
Organism
eju
Eumetopias jubatus (Steller sea lion)
Pathway
eju00220
Arginine biosynthesis
eju00250
Alanine, aspartate and glutamate metabolism
eju00270
Cysteine and methionine metabolism
eju00330
Arginine and proline metabolism
eju00350
Tyrosine metabolism
eju00360
Phenylalanine metabolism
eju00400
Phenylalanine, tyrosine and tryptophan biosynthesis
eju01100
Metabolic pathways
eju01200
Carbon metabolism
eju01210
2-Oxocarboxylic acid metabolism
eju01230
Biosynthesis of amino acids
eju04975
Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:
eju00001
]
09100 Metabolism
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
114202043 (GOT2)
00270 Cysteine and methionine metabolism
114202043 (GOT2)
00220 Arginine biosynthesis
114202043 (GOT2)
00330 Arginine and proline metabolism
114202043 (GOT2)
00350 Tyrosine metabolism
114202043 (GOT2)
00360 Phenylalanine metabolism
114202043 (GOT2)
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
114202043 (GOT2)
09150 Organismal Systems
09154 Digestive system
04975 Fat digestion and absorption
114202043 (GOT2)
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
eju01007
]
114202043 (GOT2)
Enzymes [BR:
eju01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.1 aspartate transaminase
114202043 (GOT2)
Amino acid related enzymes [BR:
eju01007
]
Aminotransferase (transaminase)
Class I
114202043 (GOT2)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Aminotran_1_2
Motif
Other DBs
NCBI-GeneID:
114202043
NCBI-ProteinID:
XP_027950822
LinkDB
All DBs
Position
Unknown
AA seq
430 aa
AA seq
DB search
MALLHSGRVLSGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIAGLADFCKASAELALGEDNEV
LKSSRYVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLHGYR
YYEPKTCGFDFTGAVEDISKMPQQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKNNLFA
FFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDADE
AKRVESQLKILIRPMYSNPPVNGARIASTILTSPDLRKQWLQEVKGMADRIISMRTQLVS
NLKKEGSSHNWQHITDQIGMFCFTGLTPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGY
LAHAIHQVTK
NT seq
1293 nt
NT seq
+upstream
nt +downstream
nt
atggccctgctgcactccggccgcgtcctgtccgggatcgccgccgctttccacccgggc
ctcgctgctgcggcttctgccagagccagctcctggtggacccatgtggaaatggggccc
ccagatcccatcctgggagtcacagaagcctttaagagagacaccaacagcaaaaagatg
aatctgggagttggtgcctaccgggatgataatggaaagccttatgtgctccctagtgtc
cggaaggcagaggcccagattgctgcaaaaaatttggacaaagagtacctgcccatcgcg
ggacttgctgacttttgtaaggcatctgcagagctagccctgggtgaggacaacgaagtg
ttgaaaagtagccggtatgtcaccgtgcagaccatttctggaactggggccttgaggatt
ggagccagttttctgcaaagattctttaagttcagccgagatgtctttctgcccaaaccg
tcctggggaaatcacacaccaatcttcagggatgccggtatgcagctgcatggttatcgc
tactacgagcccaagacgtgtggctttgacttcacaggtgctgtggaggacatttcgaaa
atgccacagcaaagcgttcttctcctgcatgcctgtgcccacaatcccacgggagtagac
ccccgtcctgagcagtggaaggaaatagcaacagtggtgaagaaaaacaatctctttgca
ttctttgacatggcctaccaaggctttgccagtggtgatggtaacaaggatgcctgggct
gtacgccacttcatcgaacagggcattaatgtttgcctctgccaatcctatgccaagaac
atgggcttatacggtgagcgtgtgggagccttcactgtggtctgcaaagatgctgatgaa
gccaaaagggtggagtcacagttgaagatcttgatccgtcccatgtattccaaccctcca
gtcaatggggcccggattgcctcgaccatcctaaccagccctgacctgcgaaaacaatgg
ttgcaggaagtaaaaggcatggccgaccgcatcattagcatgcgaactcagctggtctcc
aacctcaagaaggagggctcctcccacaactggcagcacatcactgaccagattggcatg
ttctgtttcacaggactgacacctgagcaggttgagaggctgaccaaggagttctccatc
tacatgacaaaggatggccgcatctctgtggcaggggtcacctctggcaacgtgggctac
cttgcccatgccattcaccaggtcaccaagtaa
DBGET
integrated database retrieval system