KEGG   Eumetopias jubatus (Steller sea lion): 114202996
Entry
114202996         CDS       T07240                                 
Name
(RefSeq) protein kinase C alpha type-like
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
eju  Eumetopias jubatus (Steller sea lion)
Pathway
eju01521  EGFR tyrosine kinase inhibitor resistance
eju04010  MAPK signaling pathway
eju04012  ErbB signaling pathway
eju04014  Ras signaling pathway
eju04015  Rap1 signaling pathway
eju04020  Calcium signaling pathway
eju04062  Chemokine signaling pathway
eju04064  NF-kappa B signaling pathway
eju04066  HIF-1 signaling pathway
eju04070  Phosphatidylinositol signaling system
eju04071  Sphingolipid signaling pathway
eju04082  Neuroactive ligand signaling
eju04150  mTOR signaling pathway
eju04270  Vascular smooth muscle contraction
eju04310  Wnt signaling pathway
eju04370  VEGF signaling pathway
eju04510  Focal adhesion
eju04540  Gap junction
eju04613  Neutrophil extracellular trap formation
eju04650  Natural killer cell mediated cytotoxicity
eju04662  B cell receptor signaling pathway
eju04666  Fc gamma R-mediated phagocytosis
eju04670  Leukocyte transendothelial migration
eju04713  Circadian entrainment
eju04720  Long-term potentiation
eju04723  Retrograde endocannabinoid signaling
eju04724  Glutamatergic synapse
eju04725  Cholinergic synapse
eju04726  Serotonergic synapse
eju04727  GABAergic synapse
eju04728  Dopaminergic synapse
eju04730  Long-term depression
eju04750  Inflammatory mediator regulation of TRP channels
eju04911  Insulin secretion
eju04912  GnRH signaling pathway
eju04916  Melanogenesis
eju04918  Thyroid hormone synthesis
eju04919  Thyroid hormone signaling pathway
eju04921  Oxytocin signaling pathway
eju04925  Aldosterone synthesis and secretion
eju04928  Parathyroid hormone synthesis, secretion and action
eju04929  GnRH secretion
eju04931  Insulin resistance
eju04933  AGE-RAGE signaling pathway in diabetic complications
eju04935  Growth hormone synthesis, secretion and action
eju04960  Aldosterone-regulated sodium reabsorption
eju04961  Endocrine and other factor-regulated calcium reabsorption
eju04970  Salivary secretion
eju04971  Gastric acid secretion
eju04972  Pancreatic secretion
eju04973  Carbohydrate digestion and absorption
eju05017  Spinocerebellar ataxia
eju05022  Pathways of neurodegeneration - multiple diseases
eju05031  Amphetamine addiction
eju05032  Morphine addiction
eju05140  Leishmaniasis
eju05143  African trypanosomiasis
eju05146  Amoebiasis
eju05161  Hepatitis B
eju05163  Human cytomegalovirus infection
eju05164  Influenza A
eju05170  Human immunodeficiency virus 1 infection
eju05171  Coronavirus disease - COVID-19
eju05200  Pathways in cancer
eju05205  Proteoglycans in cancer
eju05206  MicroRNAs in cancer
eju05207  Chemical carcinogenesis - receptor activation
eju05214  Glioma
eju05223  Non-small cell lung cancer
eju05225  Hepatocellular carcinoma
eju05231  Choline metabolism in cancer
eju05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:eju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114202996
   04012 ErbB signaling pathway
    114202996
   04014 Ras signaling pathway
    114202996
   04015 Rap1 signaling pathway
    114202996
   04310 Wnt signaling pathway
    114202996
   04370 VEGF signaling pathway
    114202996
   04064 NF-kappa B signaling pathway
    114202996
   04066 HIF-1 signaling pathway
    114202996
   04020 Calcium signaling pathway
    114202996
   04070 Phosphatidylinositol signaling system
    114202996
   04071 Sphingolipid signaling pathway
    114202996
   04150 mTOR signaling pathway
    114202996
  09133 Signaling molecules and interaction
   04082 Neuroactive ligand signaling
    114202996
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114202996
   04540 Gap junction
    114202996
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    114202996
   04650 Natural killer cell mediated cytotoxicity
    114202996
   04662 B cell receptor signaling pathway
    114202996
   04666 Fc gamma R-mediated phagocytosis
    114202996
   04670 Leukocyte transendothelial migration
    114202996
   04062 Chemokine signaling pathway
    114202996
  09152 Endocrine system
   04911 Insulin secretion
    114202996
   04929 GnRH secretion
    114202996
   04912 GnRH signaling pathway
    114202996
   04921 Oxytocin signaling pathway
    114202996
   04935 Growth hormone synthesis, secretion and action
    114202996
   04918 Thyroid hormone synthesis
    114202996
   04919 Thyroid hormone signaling pathway
    114202996
   04928 Parathyroid hormone synthesis, secretion and action
    114202996
   04916 Melanogenesis
    114202996
   04925 Aldosterone synthesis and secretion
    114202996
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114202996
  09154 Digestive system
   04970 Salivary secretion
    114202996
   04971 Gastric acid secretion
    114202996
   04972 Pancreatic secretion
    114202996
   04973 Carbohydrate digestion and absorption
    114202996
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    114202996
   04961 Endocrine and other factor-regulated calcium reabsorption
    114202996
  09156 Nervous system
   04724 Glutamatergic synapse
    114202996
   04727 GABAergic synapse
    114202996
   04725 Cholinergic synapse
    114202996
   04728 Dopaminergic synapse
    114202996
   04726 Serotonergic synapse
    114202996
   04720 Long-term potentiation
    114202996
   04730 Long-term depression
    114202996
   04723 Retrograde endocannabinoid signaling
    114202996
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    114202996
  09159 Environmental adaptation
   04713 Circadian entrainment
    114202996
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114202996
   05206 MicroRNAs in cancer
    114202996
   05205 Proteoglycans in cancer
    114202996
   05207 Chemical carcinogenesis - receptor activation
    114202996
   05231 Choline metabolism in cancer
    114202996
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    114202996
   05214 Glioma
    114202996
   05223 Non-small cell lung cancer
    114202996
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114202996
   05161 Hepatitis B
    114202996
   05171 Coronavirus disease - COVID-19
    114202996
   05164 Influenza A
    114202996
   05163 Human cytomegalovirus infection
    114202996
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    114202996
   05140 Leishmaniasis
    114202996
   05143 African trypanosomiasis
    114202996
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    114202996
   05022 Pathways of neurodegeneration - multiple diseases
    114202996
  09165 Substance dependence
   05031 Amphetamine addiction
    114202996
   05032 Morphine addiction
    114202996
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    114202996
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    114202996
   04933 AGE-RAGE signaling pathway in diabetic complications
    114202996
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114202996
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eju01001]
    114202996
Enzymes [BR:eju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     114202996
Protein kinases [BR:eju01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   114202996
SSDB
Motif
Pfam: C2 C1_1 C1_2 FtrD-like zf-RING-like PHD Zn_ribbon_RPB9
Other DBs
NCBI-GeneID: 114202996
NCBI-ProteinID: XP_027952191
LinkDB
Position
Unknown
AA seq 241 aa
MCFFFLQDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPS
LCGMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESK
QKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKM
PASGWYKLLNQEEGEYYNVPIPEGDEEGNVELRQKFEVRISTKLVEPSFLWEVWPQEGPE
S
NT seq 724 nt   +upstreamnt  +downstreamnt
atgtgcttcttcttcctgcaggaccccagaagcaagcacaagtttaaaatccacacctat
ggaagccccaccttttgtgatcactgtgggtccttgctgtatggacttatccatcaaggg
atgaaatgtgacacctgtgacatgaatgtgcacaagcagtgtgtgataaacgtgcccagc
ctctgcgggatggaccacacggagaagcggggccggatctacctgaaggcggaggtcacc
gatgagaagctccatgtcaccgtacgagatgcaaaaaatctaattcctatggatccaaat
gggctttcagatccgtatgtgaagctgaaacttattcctgatccgaagaatgaaagcaaa
cagaaaaccaaaaccatccgctccacactaaacccccaatggaatgagtcctttacgttc
aaattaaaaccttcggataaagaccgacggctgtccgtagaaatctgggactgggatcga
acaacaaggaatgatttcatgggatccctttcctttggagtctcggagctgatgaagatg
ccggccagtggatggtacaagctgcttaaccaagaggaaggtgagtactacaacgtaccc
attccagaaggggatgaagaaggcaacgtggagctcaggcagaaattcgaggtgagaata
tcaacgaaattagtggaaccgtcttttctttgggaagtttggcctcaggaagggccagag
tctt

DBGET integrated database retrieval system