Eumetopias jubatus (Steller sea lion): 114203796 Help Entry 114203796         CDS       T07240                                  Name (RefSeq) myosin light chain 5   KO K12753   myosin regulatory light chain 5 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04360   Axon guidance eju04510   Focal adhesion eju04520   Adherens junction eju04670   Leukocyte transendothelial migration eju04810   Regulation of actin cytoskeleton eju04814   Motor proteins eju04820   Cytoskeleton in muscle cells eju05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eju00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     114203796    04520 Adherens junction     114203796   09142 Cell motility    04814 Motor proteins     114203796    04820 Cytoskeleton in muscle cells     114203796    04810 Regulation of actin cytoskeleton     114203796  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     114203796   09158 Development and regeneration    04360 Axon guidance     114203796  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114203796  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:eju04812]     114203796 Cytoskeleton proteins [BR:eju04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      114203796 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF_EFCAB10_C AIF-1 Caleosin Motif Other DBs NCBI-GeneID:  114203796 NCBI-ProteinID:  XP_027952893 LinkDB All DBs Position Unknown AA seq 183 aa AA seqDB search MEQGKAQDKPWASRKTKKKEGGGLRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFI DKEDLKDTYASLGKTNIKDDELDAMLKEASGPINFTMFLNMFGAKLTGTDAEETILNAFK MLDPDGKGSINKDYIKRLLMSQADKMTAEEVDQMFQFATIDAAGNLDYKALSYVLTHGEE KEE NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atggagcagggcaaagctcaagacaagccctgggccagcaggaagactaagaagaaggaa gggggtggcctacgggcccagagggcatcatccaacgtcttctccaactttgagcagacc cagatccaggagttcaaggaggcattcacactaatggatcagaaccgagatggcttcatc gacaaggaggacctgaaggacacctacgcctctctgggcaaaaccaacatcaaggatgat gagctggacgccatgctcaaggaggcctcagggcccatcaacttcaccatgttcctgaac atgtttggggcgaagctgacgggtacggatgccgaggagaccatcctaaatgccttcaag atgctggatcccgatggcaaaggcagcatcaacaaggactacatcaagcggctgttgatg tcccaggcagacaagatgaccgctgaagaggttgaccagatgttccagtttgccaccatc gatgctgcaggcaacctggactataaggcactgagctatgtgctcacccacggggaggag aaggaggaatga

DBGET integrated database retrieval system