Eumetopias jubatus (Steller sea lion): 114203809 Help Entry 114203809         CDS       T07240                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04613   Neutrophil extracellular trap formation eju05034   Alcoholism eju05203   Viral carcinogenesis eju05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:eju00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114203809  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     114203809   09163 Immune disease    05322 Systemic lupus erythematosus     114203809   09165 Substance dependence    05034 Alcoholism     114203809  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eju03036]     114203809   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eju04147]     114203809 Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114203809 Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114203809 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF DUF7217 Motif Other DBs NCBI-GeneID:  114203809 NCBI-ProteinID:  XP_027952906 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MAGPGCETSSEESLSTEEPTAADPMTPKQKQPRRGGCRRGSGRGCHRRVSRRHRRRLDSF ATYFTRVLRHVHGGFSLSQEAVSVMDSFVKDIFGRIAEEASRLARSTKRSTITTMEIQTA VRLLLPGEIGKHAMSEAVKAVIRFYGRK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggctggacctggctgtgagacctcttctgaggaaagcctcagcaccgaggagcccaca gcagccgacccgatgaccccgaagcagaagcagcccaggcgcggaggctgccgccgtggc agtggccgcggctgccaccgccgtgtcagccgccgccaccgccgccgcctcgacagtttc gccacctacttcaccagggttctgaggcatgttcacgggggcttcagcctctcgcaggag gccgtgagcgtcatggattcgtttgtcaaggatatcttcgggcgcatcgctgaggaggcc tctcgccttgcccgctccaccaagcgctccaccatcaccaccatggagatccagacagct gtgcgcctgttgctgcctggggagattggcaagcatgccatgtccgaggccgtgaaggca gtcatcaggttctatggacgcaaatga

DBGET integrated database retrieval system