Eumetopias jubatus (Steller sea lion): 114205620 Help Entry 114205620         CDS       T07240                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04613   Neutrophil extracellular trap formation eju05034   Alcoholism eju05202   Transcriptional misregulation in cancer eju05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:eju00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114205620  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     114205620   09163 Immune disease    05322 Systemic lupus erythematosus     114205620   09165 Substance dependence    05034 Alcoholism     114205620  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eju03036]     114205620   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eju04147]     114205620 Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114205620 Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114205620 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CENP-T_C CENP-S YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  114205620 NCBI-ProteinID:  XP_027954942 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTAHKWTGGKAPRKQLATKAAHRSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQNAAIGALQEASEAYLVGLFEDTNLCAIHAKCVTI MSKDIQLGHRIHGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccacaaatggaccggtggtaaagcaccaaggaagcaa ctggctacaaaagctgctcacaggagtgcaccctctactggaggagtgaagaaacctcat cgttacaggcctggtactgtggccctccgtgaaattagacgttatcagaagtccaccgag cttctgatccgcaaacttcctttccagcgtctggtacgagaaattgctcaggacttcaaa acagatctgcgcttccagaatgcagctattggtgctttgcaggaagcaagcgaggcctat ctggtgggcctctttgaagacaccaacctgtgtgctatccatgccaaatgtgtcacaatt atgtcaaaagacatccagctagggcaccgcatacatggagaacgtgcttaa

DBGET integrated database retrieval system