Eumetopias jubatus (Steller sea lion): 114207931 Help Entry 114207931         CDS       T07240                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju01521   EGFR tyrosine kinase inhibitor resistance eju01522   Endocrine resistance eju04010   MAPK signaling pathway eju04012   ErbB signaling pathway eju04014   Ras signaling pathway eju04015   Rap1 signaling pathway eju04062   Chemokine signaling pathway eju04068   FoxO signaling pathway eju04071   Sphingolipid signaling pathway eju04072   Phospholipase D signaling pathway eju04137   Mitophagy - animal eju04140   Autophagy - animal eju04150   mTOR signaling pathway eju04151   PI3K-Akt signaling pathway eju04210   Apoptosis eju04211   Longevity regulating pathway eju04213   Longevity regulating pathway - multiple species eju04218   Cellular senescence eju04360   Axon guidance eju04370   VEGF signaling pathway eju04371   Apelin signaling pathway eju04540   Gap junction eju04550   Signaling pathways regulating pluripotency of stem cells eju04625   C-type lectin receptor signaling pathway eju04650   Natural killer cell mediated cytotoxicity eju04660   T cell receptor signaling pathway eju04662   B cell receptor signaling pathway eju04664   Fc epsilon RI signaling pathway eju04714   Thermogenesis eju04720   Long-term potentiation eju04722   Neurotrophin signaling pathway eju04725   Cholinergic synapse eju04726   Serotonergic synapse eju04730   Long-term depression eju04810   Regulation of actin cytoskeleton eju04910   Insulin signaling pathway eju04912   GnRH signaling pathway eju04915   Estrogen signaling pathway eju04916   Melanogenesis eju04917   Prolactin signaling pathway eju04919   Thyroid hormone signaling pathway eju04921   Oxytocin signaling pathway eju04926   Relaxin signaling pathway eju04929   GnRH secretion eju04933   AGE-RAGE signaling pathway in diabetic complications eju04935   Growth hormone synthesis, secretion and action eju05010   Alzheimer disease eju05022   Pathways of neurodegeneration - multiple diseases eju05034   Alcoholism eju05160   Hepatitis C eju05161   Hepatitis B eju05163   Human cytomegalovirus infection eju05165   Human papillomavirus infection eju05166   Human T-cell leukemia virus 1 infection eju05167   Kaposi sarcoma-associated herpesvirus infection eju05170   Human immunodeficiency virus 1 infection eju05200   Pathways in cancer eju05203   Viral carcinogenesis eju05205   Proteoglycans in cancer eju05206   MicroRNAs in cancer eju05207   Chemical carcinogenesis - receptor activation eju05208   Chemical carcinogenesis - reactive oxygen species eju05210   Colorectal cancer eju05211   Renal cell carcinoma eju05213   Endometrial cancer eju05214   Glioma eju05215   Prostate cancer eju05216   Thyroid cancer eju05218   Melanoma eju05219   Bladder cancer eju05220   Chronic myeloid leukemia eju05221   Acute myeloid leukemia eju05223   Non-small cell lung cancer eju05224   Breast cancer eju05225   Hepatocellular carcinoma eju05226   Gastric cancer eju05230   Central carbon metabolism in cancer eju05231   Choline metabolism in cancer eju05235   PD-L1 expression and PD-1 checkpoint pathway in cancer eju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114207931 (NRAS)    04012 ErbB signaling pathway     114207931 (NRAS)    04014 Ras signaling pathway     114207931 (NRAS)    04015 Rap1 signaling pathway     114207931 (NRAS)    04370 VEGF signaling pathway     114207931 (NRAS)    04371 Apelin signaling pathway     114207931 (NRAS)    04068 FoxO signaling pathway     114207931 (NRAS)    04072 Phospholipase D signaling pathway     114207931 (NRAS)    04071 Sphingolipid signaling pathway     114207931 (NRAS)    04151 PI3K-Akt signaling pathway     114207931 (NRAS)    04150 mTOR signaling pathway     114207931 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114207931 (NRAS)    04137 Mitophagy - animal     114207931 (NRAS)   09143 Cell growth and death    04210 Apoptosis     114207931 (NRAS)    04218 Cellular senescence     114207931 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     114207931 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     114207931 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     114207931 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114207931 (NRAS)    04650 Natural killer cell mediated cytotoxicity     114207931 (NRAS)    04660 T cell receptor signaling pathway     114207931 (NRAS)    04662 B cell receptor signaling pathway     114207931 (NRAS)    04664 Fc epsilon RI signaling pathway     114207931 (NRAS)    04062 Chemokine signaling pathway     114207931 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     114207931 (NRAS)    04929 GnRH secretion     114207931 (NRAS)    04912 GnRH signaling pathway     114207931 (NRAS)    04915 Estrogen signaling pathway     114207931 (NRAS)    04917 Prolactin signaling pathway     114207931 (NRAS)    04921 Oxytocin signaling pathway     114207931 (NRAS)    04926 Relaxin signaling pathway     114207931 (NRAS)    04935 Growth hormone synthesis, secretion and action     114207931 (NRAS)    04919 Thyroid hormone signaling pathway     114207931 (NRAS)    04916 Melanogenesis     114207931 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     114207931 (NRAS)    04726 Serotonergic synapse     114207931 (NRAS)    04720 Long-term potentiation     114207931 (NRAS)    04730 Long-term depression     114207931 (NRAS)    04722 Neurotrophin signaling pathway     114207931 (NRAS)   09158 Development and regeneration    04360 Axon guidance     114207931 (NRAS)   09149 Aging    04211 Longevity regulating pathway     114207931 (NRAS)    04213 Longevity regulating pathway - multiple species     114207931 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     114207931 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114207931 (NRAS)    05206 MicroRNAs in cancer     114207931 (NRAS)    05205 Proteoglycans in cancer     114207931 (NRAS)    05207 Chemical carcinogenesis - receptor activation     114207931 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     114207931 (NRAS)    05203 Viral carcinogenesis     114207931 (NRAS)    05230 Central carbon metabolism in cancer     114207931 (NRAS)    05231 Choline metabolism in cancer     114207931 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     114207931 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     114207931 (NRAS)    05225 Hepatocellular carcinoma     114207931 (NRAS)    05226 Gastric cancer     114207931 (NRAS)    05214 Glioma     114207931 (NRAS)    05216 Thyroid cancer     114207931 (NRAS)    05221 Acute myeloid leukemia     114207931 (NRAS)    05220 Chronic myeloid leukemia     114207931 (NRAS)    05218 Melanoma     114207931 (NRAS)    05211 Renal cell carcinoma     114207931 (NRAS)    05219 Bladder cancer     114207931 (NRAS)    05215 Prostate cancer     114207931 (NRAS)    05213 Endometrial cancer     114207931 (NRAS)    05224 Breast cancer     114207931 (NRAS)    05223 Non-small cell lung cancer     114207931 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     114207931 (NRAS)    05170 Human immunodeficiency virus 1 infection     114207931 (NRAS)    05161 Hepatitis B     114207931 (NRAS)    05160 Hepatitis C     114207931 (NRAS)    05163 Human cytomegalovirus infection     114207931 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     114207931 (NRAS)    05165 Human papillomavirus infection     114207931 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     114207931 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     114207931 (NRAS)   09165 Substance dependence    05034 Alcoholism     114207931 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114207931 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     114207931 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     114207931 (NRAS)    01522 Endocrine resistance     114207931 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eju04131]     114207931 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eju04147]     114207931 (NRAS)    04031 GTP-binding proteins [BR:eju04031]     114207931 (NRAS) Membrane trafficking [BR:eju04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     114207931 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     114207931 (NRAS) Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114207931 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    114207931 (NRAS)   Exosomal proteins of breast cancer cells    114207931 (NRAS)   Exosomal proteins of colorectal cancer cells    114207931 (NRAS) GTP-binding proteins [BR:eju04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     114207931 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  114207931 NCBI-ProteinID:  XP_027957797 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgtcgggaaaagcgcattgaca atccagctaatccagaaccactttgtagatgagtatgatcccaccatagaggattcttac cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgagtaaaagattcagatgatgtacctatggtgctagtaggaaataagtgtgatttg ccaacaaggacagtggacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcaatgatgatgggactcaaggt tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system