Eumetopias jubatus (Steller sea lion): 114207940 Help Entry 114207940         CDS       T07240                                  Name (RefSeq) glutathione S-transferase Mu 3   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju00480   Glutathione metabolism eju00980   Metabolism of xenobiotics by cytochrome P450 eju00982   Drug metabolism - cytochrome P450 eju00983   Drug metabolism - other enzymes eju01100   Metabolic pathways eju01524   Platinum drug resistance eju05200   Pathways in cancer eju05204   Chemical carcinogenesis - DNA adducts eju05207   Chemical carcinogenesis - receptor activation eju05208   Chemical carcinogenesis - reactive oxygen species eju05225   Hepatocellular carcinoma eju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     114207940   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     114207940    00982 Drug metabolism - cytochrome P450     114207940    00983 Drug metabolism - other enzymes     114207940  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114207940    05204 Chemical carcinogenesis - DNA adducts     114207940    05207 Chemical carcinogenesis - receptor activation     114207940    05208 Chemical carcinogenesis - reactive oxygen species     114207940   09162 Cancer: specific types    05225 Hepatocellular carcinoma     114207940   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     114207940   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     114207940  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:eju02000]     114207940 Enzymes [BR:eju01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      114207940 Transporters [BR:eju02000]  Other transporters   Pores ion channels [TC:1]    114207940 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C GST_N GST_C_3 GST_N_3 GST_N_2 GST_C_6 Motif Other DBs NCBI-GeneID:  114207940 NCBI-ProteinID:  XP_027957808 LinkDB All DBs Position Unknown AA seq 226 aa AA seqDB search MSLSKSTMVLGYWDIRGLAHAIRMLLEFTDTSYEEKQYTCGEAPDYDRSQWLDVKFKLDL DFPNLPYLMDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIMENQIMDFRTQLIRLC YSPDLDKLKPQYLEQLPGQLKQFSLFLGKFSWFAGEKLTFVDFLTYDVLDQNRLFEPKCL DEFPNLKAFMCRFEALEKIANYMQSDRFLKMPINNKMAQWGNKRTC NT seq 681 nt NT seq  +upstreamnt  +downstreamnt atgtcgttgtccaagtcgaccatggttctaggttactgggatattcgcgggctggcgcac gccatccgcatgctcctggagttcactgatacatcctatgaggagaaacagtacacgtgc ggggaagctcccgactatgatagaagccaatggctggatgtgaaattcaagctcgacctg gactttcctaacctgccctacctcatggatggtaagaacaagatcacccagagcaatgct atcttgcgctacatcgctcgcaagcacaatatgtgtggtgagactgaagaagaaaagatt cgagtggacatcatggagaaccaaataatggatttccgtacgcagctgatacgactgtgc tatagccctgaccttgacaaactgaagcctcagtacttggaacagctacctggacaactg aaacagttctccttgttcctggggaaattctcatggtttgcaggagaaaagctcaccttt gtggatttcctcacctatgatgtcttagatcagaaccgtctgtttgagcccaagtgcctg gatgaatttccaaatctgaaggctttcatgtgccgttttgaggctttggagaagatcgct aactacatgcagtctgaccgcttcctgaagatgcccatcaacaacaagatggcgcagtgg ggcaacaagagaacatgctga

DBGET integrated database retrieval system