Eumetopias jubatus (Steller sea lion): 114208730 Help Entry 114208730         CDS       T07240                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04015   Rap1 signaling pathway eju04810   Regulation of actin cytoskeleton eju05014   Amyotrophic lateral sclerosis eju05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     114208730 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     114208730 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114208730 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     114208730 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eju04131]     114208730 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:eju04812]     114208730 (PFN3)    04147 Exosome [BR:eju04147]     114208730 (PFN3) Membrane trafficking [BR:eju04131]  Others   Actin-binding proteins    Others     114208730 (PFN3) Cytoskeleton proteins [BR:eju04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      114208730 (PFN3) Exosome [BR:eju04147]  Exosomal proteins   Proteins found in most exosomes    114208730 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  114208730 NCBI-ProteinID:  XP_027958630 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKSYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QSGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI LNKTVHKLIKGLRMQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaaaagctatatcagtgcggtgctgcgggaccagcgcattgacgacgtg gccatcgtgggtcactcggacaatcgctgcgtgtgggcatcgcgccccggaggccttctg gctgccatatcaccgcaagaggtgggtgtgctcacaggtcctgaccggcgcaccttcctg cagtcaggcctgagcgtggcaggccgccgctgctgcgtcatccgcgaccacttgctatct gagggcgatggagttctggacgcacgcactaaagggctggatgggcgcgcggtctgcgtg ggccacaccccgcgtgtgctcctcgtgctcatgggccggcgcggcgtgcacgggggcatc ctcaacaagacagtgcataaactgatcaaggggctacgcatgcagggcacctag

DBGET integrated database retrieval system