Eumetopias jubatus (Steller sea lion): 114208935 Help Entry 114208935         CDS       T07240                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism eju  Eumetopias jubatus (Steller sea lion) Brite KEGG Orthology (KO) [BR:eju00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:eju03041]     114208935   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114208935 Spliceosome [BR:eju03041]  Complex B   Other components    Complex B specific factors     114208935 Cytokines and neuropeptides [BR:eju04052]  Neuropeptides   Unclassified    114208935 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler PI3K_rbd OTU1_UBXL Motif Other DBs NCBI-GeneID:  114208935 NCBI-ProteinID:  XP_027958813 LinkDB All DBs Position Unknown AA seq 72 aa AA seqDB search MIEVVCNDHLGKKVRVKCNTDDTVGDLKKLIAAQTGTRWNKIVLKWYTIFKDHVSLGHYE IHDGMNLELYYQ NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtttgcaatgaccatctagggaagaaggtccgcgttaagtgcaacact gatgacaccgtcggggaccttaagaagctgatcgcagcccaaactggcacccgttggaac aagatcgtcctgaagtggtacacaatttttaaggaccatgtgtctctggggcactatgaa atccatgatgggatgaacctggagctttattaccaatag

DBGET integrated database retrieval system