Eumetopias jubatus (Steller sea lion): 114209150 Help Entry 114209150         CDS       T07240                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04620   Toll-like receptor signaling pathway eju04622   RIG-I-like receptor signaling pathway eju04625   C-type lectin receptor signaling pathway eju04630   JAK-STAT signaling pathway eju04658   Th1 and Th2 cell differentiation eju04936   Alcoholic liver disease eju04940   Type I diabetes mellitus eju05133   Pertussis eju05134   Legionellosis eju05140   Leishmaniasis eju05142   Chagas disease eju05143   African trypanosomiasis eju05144   Malaria eju05145   Toxoplasmosis eju05146   Amoebiasis eju05152   Tuberculosis eju05162   Measles eju05164   Influenza A eju05168   Herpes simplex virus 1 infection eju05171   Coronavirus disease - COVID-19 eju05200   Pathways in cancer eju05321   Inflammatory bowel disease eju05330   Allograft rejection eju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     114209150 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114209150 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114209150 (IL12A)    04622 RIG-I-like receptor signaling pathway     114209150 (IL12A)    04625 C-type lectin receptor signaling pathway     114209150 (IL12A)    04658 Th1 and Th2 cell differentiation     114209150 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114209150 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     114209150 (IL12A)    05164 Influenza A     114209150 (IL12A)    05162 Measles     114209150 (IL12A)    05168 Herpes simplex virus 1 infection     114209150 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     114209150 (IL12A)    05134 Legionellosis     114209150 (IL12A)    05152 Tuberculosis     114209150 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     114209150 (IL12A)    05144 Malaria     114209150 (IL12A)    05145 Toxoplasmosis     114209150 (IL12A)    05140 Leishmaniasis     114209150 (IL12A)    05142 Chagas disease     114209150 (IL12A)    05143 African trypanosomiasis     114209150 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     114209150 (IL12A)    05330 Allograft rejection     114209150 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114209150 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     114209150 (IL12A)    04936 Alcoholic liver disease     114209150 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114209150 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:eju00536]     114209150 (IL12A) Cytokines and neuropeptides [BR:eju04052]  Cytokines   Interleukins    114209150 (IL12A) Glycosaminoglycan binding proteins [BR:eju00536]  Heparan sulfate / Heparin   Cytokines    114209150 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  114209150 NCBI-ProteinID:  XP_027958988 LinkDB All DBs Position Unknown AA seq 222 aa AA seqDB search MCPPRGLLLVTILVLLNHLDHLSLARSLPTASPSPGMFQCLNHSQNLLKAVSNTLQKARQ TLELYSCTSEEIDHEDITKDKTSTVEACLPLELTMNESCLASREIFLITNGSCLASRKAS FMTTLCLSSIYEDLKMYQIEFKAMNAKLLMDPKRQIFLDQNMLTAIDELLQALNFNSATV PQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgtgcccgccgcgcggcctcctccttgtgaccatcctggtcctcctaaaccacctggac cacctcagtttggccaggagcctccccacagcctcaccaagcccaggaatgttccagtgc ctcaaccactcccaaaacctgctgaaagccgtcagcaacacgcttcagaaggccagacaa accctagaactttattcctgcacttccgaagagattgatcatgaagatatcacaaaggat aaaaccagcacagtggaggcctgcttaccattggaattaaccatgaatgagagttgcctg gcttccagagagatctttttgataactaatgggagttgcctggcctccagaaaggcatct tttatgacgaccctgtgccttagcagtatctatgaggacttgaagatgtaccagatagag ttcaaggccatgaacgcaaagcttttaatggatcctaagaggcagatctttctggatcaa aacatgctgacagctattgatgagctcttacaggccctgaatttcaacagtgcgactgtg ccacagaaatcctcccttgaagaaccggatttctataaaactaaaatcaagctctgcata cttcttcatgctttcagaattcgtgcagtgaccatcgatagaatgatgagctatctgaat tcttcctaa

DBGET integrated database retrieval system