Eumetopias jubatus (Steller sea lion): 114209410 Help Entry 114209410         CDS       T07240                                  Name (RefSeq) interleukin-3-like   KO K04736   interleukin 3 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04151   PI3K-Akt signaling pathway eju04210   Apoptosis eju04630   JAK-STAT signaling pathway eju04640   Hematopoietic cell lineage eju04664   Fc epsilon RI signaling pathway eju05200   Pathways in cancer eju05202   Transcriptional misregulation in cancer eju05221   Acute myeloid leukemia eju05310   Asthma Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     114209410    04151 PI3K-Akt signaling pathway     114209410   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114209410  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     114209410  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     114209410    04664 Fc epsilon RI signaling pathway     114209410  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114209410    05202 Transcriptional misregulation in cancer     114209410   09162 Cancer: specific types    05221 Acute myeloid leukemia     114209410   09163 Immune disease    05310 Asthma     114209410  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114209410    00536 Glycosaminoglycan binding proteins [BR:eju00536]     114209410 Cytokines and neuropeptides [BR:eju04052]  Cytokines   Interleukins    114209410 Glycosaminoglycan binding proteins [BR:eju00536]  Heparan sulfate / Heparin   Cytokines    114209410 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL3 Motif Other DBs NCBI-GeneID:  114209410 NCBI-ProteinID:  XP_027959249 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MNSLPILHLLLFLLGFQALQAQGRSLSAYQPKQYFKMISEIMDVLNTSPSPSEEALDPNE INTLLNTTLLRPNLDAFLNATKNFYNNESLIWKNLKEFLPLLPNPTPRGEPIYIENNWDD FQKKLKKYLEALDNFLTFKNKH NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgaacagcctccccatcctgcatcttctcctgttcctgcttggattccaagccctacag gcacaggggcggtccttgtcggcataccagcctaagcaatacttcaagatgatcagtgaa attatggacgtcttaaacacttcaccctcgccttcagaagaagccttggacccaaatgag ataaacaccctgctgaacactactcttctgaggccaaacctggatgcattcttgaatgct accaaaaatttctacaacaatgagtcactaatctggaaaaatcttaaggaattcctgcca ctcctgcccaatcccacacccaggggagaaccgatctatattgagaataactgggatgat ttccaaaagaagctgaaaaaatatctggaggcccttgataactttctgactttcaagaac aagcactga

DBGET integrated database retrieval system