Eumetopias jubatus (Steller sea lion): 114209600 Help Entry 114209600         CDS       T07240                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04630   JAK-STAT signaling pathway eju04640   Hematopoietic cell lineage eju04657   IL-17 signaling pathway eju04658   Th1 and Th2 cell differentiation eju04660   T cell receptor signaling pathway eju04664   Fc epsilon RI signaling pathway eju04672   Intestinal immune network for IgA production eju05200   Pathways in cancer eju05310   Asthma eju05320   Autoimmune thyroid disease eju05321   Inflammatory bowel disease eju05330   Allograft rejection Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     114209600 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114209600 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     114209600 (IL5)    04660 T cell receptor signaling pathway     114209600 (IL5)    04658 Th1 and Th2 cell differentiation     114209600 (IL5)    04657 IL-17 signaling pathway     114209600 (IL5)    04664 Fc epsilon RI signaling pathway     114209600 (IL5)    04672 Intestinal immune network for IgA production     114209600 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114209600 (IL5)   09163 Immune disease    05310 Asthma     114209600 (IL5)    05320 Autoimmune thyroid disease     114209600 (IL5)    05321 Inflammatory bowel disease     114209600 (IL5)    05330 Allograft rejection     114209600 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114209600 (IL5)    00536 Glycosaminoglycan binding proteins [BR:eju00536]     114209600 (IL5) Cytokines and neuropeptides [BR:eju04052]  Cytokines   Interleukins    114209600 (IL5) Glycosaminoglycan binding proteins [BR:eju00536]  Heparan sulfate / Heparin   Cytokines    114209600 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  114209600 NCBI-ProteinID:  XP_027959500 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVSVTAVESTMNSLVAETLTLLSAHRTLLIGDGNLMIPTPEHKNH QLCIEEVFQGIDILKNQTAQGEAVDKLFQNLSLIKEHIDLQKKKCGGERWRVKKFLDYLQ VFLGVINTEWTTES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact gctgtagaaagtaccatgaatagtctggtcgcagagaccttgacactgctctccgctcat cgaactctgctgataggcgatgggaacctgatgattcctactcctgaacataaaaatcac caattgtgcattgaagaagtctttcagggtatagacatattgaagaaccaaactgcacaa ggggaggctgtggataaattattccaaaacttgtctttgataaaagaacacatagacctc caaaaaaaaaagtgtggaggagaaagatggagagtgaaaaagttcctagactacctgcaa gtgtttcttggtgtcataaacaccgagtggacaacagaaagttga

DBGET integrated database retrieval system