Eumetopias jubatus (Steller sea lion): 114209729 Help Entry 114209729         CDS       T07240                                  Name (RefSeq) tubulin beta chain   KO K07375   tubulin beta Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04145   Phagosome eju04540   Gap junction eju04814   Motor proteins eju05010   Alzheimer disease eju05012   Parkinson disease eju05014   Amyotrophic lateral sclerosis eju05016   Huntington disease eju05020   Prion disease eju05022   Pathways of neurodegeneration - multiple diseases eju05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eju00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     114209729   09144 Cellular community - eukaryotes    04540 Gap junction     114209729   09142 Cell motility    04814 Motor proteins     114209729  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114209729   09164 Neurodegenerative disease    05010 Alzheimer disease     114209729    05012 Parkinson disease     114209729    05014 Amyotrophic lateral sclerosis     114209729    05016 Huntington disease     114209729    05020 Prion disease     114209729    05022 Pathways of neurodegeneration - multiple diseases     114209729  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eju03036]     114209729   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:eju04812]     114209729    04147 Exosome [BR:eju04147]     114209729 Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      114209729 Cytoskeleton proteins [BR:eju04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     114209729 Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    114209729   Exosomal proteins of colorectal cancer cells    114209729   Exosomal proteins of bladder cancer cells    114209729 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tubulin_C Motif Other DBs NCBI-GeneID:  114209729 NCBI-ProteinID:  XP_027959651 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MCLFQYKNNVTPRHGRYLTVAAVFRGRMSMKQVDEQMLNVQNKNSSYFVEWIPNSVKTAV CDIPPRGLKMSATFIGNSTAIQELFKRISEQFAAMFRRKAFLHWYTGEGMDEMEFTEAES NMNDLVSEYQQYQDATAEEAGEFEEEAEEEVA NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtgcctttttcaatataaaaataatgtcactccacgccatggccgctacctgaccgtg gccgcagtattcaggggccgcatgtccatgaagcaggtggatgagcagatgctgaacgtg cagaacaagaacagcagctacttcgtggagtggatccccaacagcgtgaagacagctgtg tgtgacatcccaccccgggggctaaaaatgtctgccactttcatcggcaacagcacggcc atccaggagctgttcaagcgcatctcggagcagttcgccgccatgttccggcgcaaggcc ttcctgcactggtacacgggcgagggcatggacgagatggagttcaccgaggccgagagc aacatgaacgacctggtgtccgagtaccagcagtaccaggacgccacggccgaggaggcg ggcgagtttgaggaggaggccgaggaggaggtggcctag

DBGET integrated database retrieval system