KEGG   Eumetopias jubatus (Steller sea lion): 114210095
Entry
114210095         CDS       T07240                                 
Name
(RefSeq) LOW QUALITY PROTEIN: ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
eju  Eumetopias jubatus (Steller sea lion)
Pathway
eju04010  MAPK signaling pathway
eju04014  Ras signaling pathway
eju04015  Rap1 signaling pathway
eju04024  cAMP signaling pathway
eju04062  Chemokine signaling pathway
eju04071  Sphingolipid signaling pathway
eju04145  Phagosome
eju04148  Efferocytosis
eju04151  PI3K-Akt signaling pathway
eju04310  Wnt signaling pathway
eju04360  Axon guidance
eju04370  VEGF signaling pathway
eju04380  Osteoclast differentiation
eju04510  Focal adhesion
eju04520  Adherens junction
eju04530  Tight junction
eju04613  Neutrophil extracellular trap formation
eju04620  Toll-like receptor signaling pathway
eju04650  Natural killer cell mediated cytotoxicity
eju04662  B cell receptor signaling pathway
eju04664  Fc epsilon RI signaling pathway
eju04666  Fc gamma R-mediated phagocytosis
eju04670  Leukocyte transendothelial migration
eju04722  Neurotrophin signaling pathway
eju04810  Regulation of actin cytoskeleton
eju04932  Non-alcoholic fatty liver disease
eju04933  AGE-RAGE signaling pathway in diabetic complications
eju04972  Pancreatic secretion
eju05014  Amyotrophic lateral sclerosis
eju05020  Prion disease
eju05022  Pathways of neurodegeneration - multiple diseases
eju05100  Bacterial invasion of epithelial cells
eju05132  Salmonella infection
eju05135  Yersinia infection
eju05163  Human cytomegalovirus infection
eju05167  Kaposi sarcoma-associated herpesvirus infection
eju05169  Epstein-Barr virus infection
eju05170  Human immunodeficiency virus 1 infection
eju05200  Pathways in cancer
eju05203  Viral carcinogenesis
eju05205  Proteoglycans in cancer
eju05208  Chemical carcinogenesis - reactive oxygen species
eju05210  Colorectal cancer
eju05211  Renal cell carcinoma
eju05212  Pancreatic cancer
eju05231  Choline metabolism in cancer
eju05415  Diabetic cardiomyopathy
eju05416  Viral myocarditis
eju05417  Lipid and atherosclerosis
eju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:eju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114210095
   04014 Ras signaling pathway
    114210095
   04015 Rap1 signaling pathway
    114210095
   04310 Wnt signaling pathway
    114210095
   04370 VEGF signaling pathway
    114210095
   04071 Sphingolipid signaling pathway
    114210095
   04024 cAMP signaling pathway
    114210095
   04151 PI3K-Akt signaling pathway
    114210095
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    114210095
   04148 Efferocytosis
    114210095
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114210095
   04520 Adherens junction
    114210095
   04530 Tight junction
    114210095
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114210095
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    114210095
   04620 Toll-like receptor signaling pathway
    114210095
   04650 Natural killer cell mediated cytotoxicity
    114210095
   04662 B cell receptor signaling pathway
    114210095
   04664 Fc epsilon RI signaling pathway
    114210095
   04666 Fc gamma R-mediated phagocytosis
    114210095
   04670 Leukocyte transendothelial migration
    114210095
   04062 Chemokine signaling pathway
    114210095
  09154 Digestive system
   04972 Pancreatic secretion
    114210095
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    114210095
  09158 Development and regeneration
   04360 Axon guidance
    114210095
   04380 Osteoclast differentiation
    114210095
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114210095
   05205 Proteoglycans in cancer
    114210095
   05208 Chemical carcinogenesis - reactive oxygen species
    114210095
   05203 Viral carcinogenesis
    114210095
   05231 Choline metabolism in cancer
    114210095
  09162 Cancer: specific types
   05210 Colorectal cancer
    114210095
   05212 Pancreatic cancer
    114210095
   05211 Renal cell carcinoma
    114210095
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114210095
   05163 Human cytomegalovirus infection
    114210095
   05167 Kaposi sarcoma-associated herpesvirus infection
    114210095
   05169 Epstein-Barr virus infection
    114210095
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114210095
   05135 Yersinia infection
    114210095
   05100 Bacterial invasion of epithelial cells
    114210095
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    114210095
   05020 Prion disease
    114210095
   05022 Pathways of neurodegeneration - multiple diseases
    114210095
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114210095
   05418 Fluid shear stress and atherosclerosis
    114210095
   05415 Diabetic cardiomyopathy
    114210095
   05416 Viral myocarditis
    114210095
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    114210095
   04933 AGE-RAGE signaling pathway in diabetic complications
    114210095
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eju04131]
    114210095
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eju04147]
    114210095
   04031 GTP-binding proteins [BR:eju04031]
    114210095
Membrane trafficking [BR:eju04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    114210095
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    114210095
  Macropinocytosis
   Ras GTPases
    114210095
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    114210095
Exosome [BR:eju04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114210095
  Exosomal proteins of other body fluids (saliva and urine)
   114210095
  Exosomal proteins of colorectal cancer cells
   114210095
  Exosomal proteins of bladder cancer cells
   114210095
GTP-binding proteins [BR:eju04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    114210095
SSDB
Motif
Pfam: Ras Roc CagD
Other DBs
NCBI-GeneID: 114210095
NCBI-ProteinID: XP_027960136
LinkDB
Position
Unknown
AA seq 135 aa
MTIIVFVDQLHPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKL
DLRDDKDKIKKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTHRGLKTVFDEAILAVL
CXPPIKKRKRKCLLL
NT seq 408 nt   +upstreamnt  +downstreamnt
atgacaataatcgtttttgtggaccaattacatcccttatcctatccacaaacagatgta
ttcttaatttgcttttctcttgtgagtcctgcatcatttgaaaatgttcgagcaaagtgg
taccccgaagtgcgacaccactgtcccaacacccccatcatcttggtggggactaaactt
gatctcagggatgacaaagacaagatcaagaagctgaaggaaaagaagctgactcctatc
acctacccacagggtctggccatggctaaggagattggtgcagtaaaatacctagagtgc
tcggcactcactcatcgaggcctcaagacagtgtttgatgaagcgattctagcggttctc
tgcncccctcccatcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system