Eumetopias jubatus (Steller sea lion): 114210913 Help Entry 114210913         CDS       T07240                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04022   cGMP-PKG signaling pathway eju04081   Hormone signaling eju04270   Vascular smooth muscle contraction eju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     114210913 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     114210913 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     114210913 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     114210913 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114210913 (NPPC) Cytokines and neuropeptides [BR:eju04052]  Neuropeptides   Unclassified    114210913 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  114210913 NCBI-ProteinID:  XP_027961178 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctactctcgctccggccc tccgaagccaagcccggggcgccgccgaaggtcccgcgaactccgccgggagaggagctg gctgagccccaggctgcgggcggcggtcagaagaagggcgacaaaactcccgggggcgga ggcgccaacctcaagggcgaccggtcgcgactgctccgcgacctgcgcgtggacaccaag tcgcgtgcggcgtgggcccgccttctgcatgagcaccccaacgcgcgcaaatacaaagga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system