Eumetopias jubatus (Steller sea lion): 114211944 Help Entry 114211944         CDS       T07240                                  Symbol IL12B Name (RefSeq) interleukin-12 subunit beta   KO K05425   interleukin 12B Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04620   Toll-like receptor signaling pathway eju04622   RIG-I-like receptor signaling pathway eju04625   C-type lectin receptor signaling pathway eju04630   JAK-STAT signaling pathway eju04658   Th1 and Th2 cell differentiation eju04936   Alcoholic liver disease eju04940   Type I diabetes mellitus eju05133   Pertussis eju05134   Legionellosis eju05140   Leishmaniasis eju05142   Chagas disease eju05143   African trypanosomiasis eju05145   Toxoplasmosis eju05146   Amoebiasis eju05152   Tuberculosis eju05162   Measles eju05164   Influenza A eju05168   Herpes simplex virus 1 infection eju05171   Coronavirus disease - COVID-19 eju05200   Pathways in cancer eju05205   Proteoglycans in cancer eju05321   Inflammatory bowel disease eju05330   Allograft rejection eju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     114211944 (IL12B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114211944 (IL12B)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114211944 (IL12B)    04622 RIG-I-like receptor signaling pathway     114211944 (IL12B)    04625 C-type lectin receptor signaling pathway     114211944 (IL12B)    04658 Th1 and Th2 cell differentiation     114211944 (IL12B)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114211944 (IL12B)    05205 Proteoglycans in cancer     114211944 (IL12B)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     114211944 (IL12B)    05164 Influenza A     114211944 (IL12B)    05162 Measles     114211944 (IL12B)    05168 Herpes simplex virus 1 infection     114211944 (IL12B)   09171 Infectious disease: bacterial    05133 Pertussis     114211944 (IL12B)    05134 Legionellosis     114211944 (IL12B)    05152 Tuberculosis     114211944 (IL12B)   09174 Infectious disease: parasitic    05146 Amoebiasis     114211944 (IL12B)    05145 Toxoplasmosis     114211944 (IL12B)    05140 Leishmaniasis     114211944 (IL12B)    05142 Chagas disease     114211944 (IL12B)    05143 African trypanosomiasis     114211944 (IL12B)   09163 Immune disease    05321 Inflammatory bowel disease     114211944 (IL12B)    05330 Allograft rejection     114211944 (IL12B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114211944 (IL12B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     114211944 (IL12B)    04936 Alcoholic liver disease     114211944 (IL12B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114211944 (IL12B)    00536 Glycosaminoglycan binding proteins [BR:eju00536]     114211944 (IL12B) Cytokines and neuropeptides [BR:eju04052]  Cytokines   Interleukins    114211944 (IL12B) Glycosaminoglycan binding proteins [BR:eju00536]  Heparan sulfate / Heparin   Cytokines    114211944 (IL12B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12p40_C Ig_3 Ig_5 Ig_2 Ig_4 ig fn3 DBD_Tnp_Mut I-set IntS9_C Motif Other DBs NCBI-GeneID:  114211944 NCBI-ProteinID:  XP_027962462 LinkDB All DBs Position Unknown AA seq 329 aa AA seqDB search MHPQQLVVSWFSLVLLPSPLMAIWELEKNVYVVELDWHLDAPGEMVVLTCHTPEEDDITW TADQSSEVLGSGKTLTIQVKEFGDAGRYTCHKGGKVLSHSLLLIHKKEDGIWSTDILKEQ KESKNKFFLKCEAKNYSGHFTCWWLTAISTDLKFSVKSSRGFSDPQGVTCGAVTLSAERV RVDNRDYKKYTVECQEGSTCPAAEESLPIEVVVGAIHKLKYENYTSSFFIRDIIKPDPPM NLQLKPLPNSRHVEVSWEYPDTWSTPHSYFSLTFCIQGQGKNNREKKERLCVDKTSAKVT CHKDAKIRVQARDRYYSSFWSDWASVSCS NT seq 990 nt NT seq  +upstreamnt  +downstreamnt atgcatcctcagcagctggtcgtctcttggttttccctggttttgctgccatctcccctc atggccatatgggaactggagaaaaatgtttatgttgtagagttggattggcacctggac gcacccggagaaatggtggtcctcacctgccatacccctgaagaagatgacatcacctgg accgcggaccagagcagtgaagtcttaggttctggtaaaactctgaccatccaagtcaaa gaatttggagatgctggccggtatacttgtcataaaggaggcaaggttctgagccattca ctcctgctgattcacaaaaaggaagatggaatttggtccactgatatcttgaaggaacag aaagaatccaaaaataagttctttctaaaatgtgaggcaaagaattattctggacatttc acctgctggtggctgacggcaatcagtactgacttgaaattcagtgtcaagagcagcaga ggcttctctgacccccaaggggtgacatgtggagcagtgacactctcagcagagagggtc agagtggacaacagggattataagaagtacaccgtggagtgtcaggagggcagcacctgc cccgcggccgaggagagcctacccatcgaggtcgtggtgggtgccattcacaagctcaag tatgaaaactacaccagcagcttcttcatcagggacatcatcaaaccggacccgcccatg aacctgcagctgaaaccactaccaaactctcggcatgtggaggtcagctgggaataccct gacacctggagcaccccgcattcctacttctccctgacattctgcatacagggccagggc aagaacaatagggaaaagaaagagagactctgcgtggacaaaacctcagccaaggtcacg tgccacaaggatgccaagatccgcgtgcaagcccgagaccgctactatagctccttctgg agtgactgggcatctgtgtcctgcagttag

DBGET integrated database retrieval system