Eumetopias jubatus (Steller sea lion): 114212893 Help Entry 114212893         CDS       T07240                                  Name (RefSeq) histone H3.3C-like   KO K11253   histone H3 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04613   Neutrophil extracellular trap formation eju05034   Alcoholism eju05202   Transcriptional misregulation in cancer eju05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:eju00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114212893  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     114212893   09163 Immune disease    05322 Systemic lupus erythematosus     114212893   09165 Substance dependence    05034 Alcoholism     114212893  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eju03036]     114212893   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eju04147]     114212893 Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114212893 Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114212893 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  114212893 NCBI-ProteinID:  XP_027963716 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MACTKQTAHKSTGGKAPRKQLAIKATRKSAPSTGGVKKPHRYRPGTVALREIRRYQKSSK LLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEANEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLACRIHGERAYPL NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggcttgtacaaagcagactgcccacaaatcgaccggtggtaaagcaccgaggaagcaa ctggctataaaagccactcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccagcaaa cttctgatccgcaaacttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcggctgttggtgctttgcaggaggcaaacgaggcctat ctggtgggcctctttgaagacaccaatctgtgtgctatccatgccaaacgtgtcacaatt atgccaaaagacatccagctagcgtgccgcatacatggagaacgtgcttatccactatga

DBGET integrated database retrieval system