Eumetopias jubatus (Steller sea lion): 114213217 Help Entry 114213217         CDS       T07240                                  Symbol CALML6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04014   Ras signaling pathway eju04015   Rap1 signaling pathway eju04020   Calcium signaling pathway eju04022   cGMP-PKG signaling pathway eju04024   cAMP signaling pathway eju04070   Phosphatidylinositol signaling system eju04114   Oocyte meiosis eju04218   Cellular senescence eju04261   Adrenergic signaling in cardiomyocytes eju04270   Vascular smooth muscle contraction eju04371   Apelin signaling pathway eju04625   C-type lectin receptor signaling pathway eju04713   Circadian entrainment eju04720   Long-term potentiation eju04722   Neurotrophin signaling pathway eju04728   Dopaminergic synapse eju04740   Olfactory transduction eju04744   Phototransduction eju04750   Inflammatory mediator regulation of TRP channels eju04910   Insulin signaling pathway eju04912   GnRH signaling pathway eju04915   Estrogen signaling pathway eju04916   Melanogenesis eju04921   Oxytocin signaling pathway eju04922   Glucagon signaling pathway eju04924   Renin secretion eju04925   Aldosterone synthesis and secretion eju04970   Salivary secretion eju04971   Gastric acid secretion eju05010   Alzheimer disease eju05012   Parkinson disease eju05022   Pathways of neurodegeneration - multiple diseases eju05031   Amphetamine addiction eju05034   Alcoholism eju05133   Pertussis eju05152   Tuberculosis eju05163   Human cytomegalovirus infection eju05167   Kaposi sarcoma-associated herpesvirus infection eju05170   Human immunodeficiency virus 1 infection eju05200   Pathways in cancer eju05214   Glioma eju05417   Lipid and atherosclerosis eju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     114213217 (CALML6)    04015 Rap1 signaling pathway     114213217 (CALML6)    04371 Apelin signaling pathway     114213217 (CALML6)    04020 Calcium signaling pathway     114213217 (CALML6)    04070 Phosphatidylinositol signaling system     114213217 (CALML6)    04024 cAMP signaling pathway     114213217 (CALML6)    04022 cGMP-PKG signaling pathway     114213217 (CALML6)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     114213217 (CALML6)    04218 Cellular senescence     114213217 (CALML6)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114213217 (CALML6)   09152 Endocrine system    04910 Insulin signaling pathway     114213217 (CALML6)    04922 Glucagon signaling pathway     114213217 (CALML6)    04912 GnRH signaling pathway     114213217 (CALML6)    04915 Estrogen signaling pathway     114213217 (CALML6)    04921 Oxytocin signaling pathway     114213217 (CALML6)    04916 Melanogenesis     114213217 (CALML6)    04924 Renin secretion     114213217 (CALML6)    04925 Aldosterone synthesis and secretion     114213217 (CALML6)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     114213217 (CALML6)    04270 Vascular smooth muscle contraction     114213217 (CALML6)   09154 Digestive system    04970 Salivary secretion     114213217 (CALML6)    04971 Gastric acid secretion     114213217 (CALML6)   09156 Nervous system    04728 Dopaminergic synapse     114213217 (CALML6)    04720 Long-term potentiation     114213217 (CALML6)    04722 Neurotrophin signaling pathway     114213217 (CALML6)   09157 Sensory system    04744 Phototransduction     114213217 (CALML6)    04740 Olfactory transduction     114213217 (CALML6)    04750 Inflammatory mediator regulation of TRP channels     114213217 (CALML6)   09159 Environmental adaptation    04713 Circadian entrainment     114213217 (CALML6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114213217 (CALML6)   09162 Cancer: specific types    05214 Glioma     114213217 (CALML6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     114213217 (CALML6)    05163 Human cytomegalovirus infection     114213217 (CALML6)    05167 Kaposi sarcoma-associated herpesvirus infection     114213217 (CALML6)   09171 Infectious disease: bacterial    05133 Pertussis     114213217 (CALML6)    05152 Tuberculosis     114213217 (CALML6)   09164 Neurodegenerative disease    05010 Alzheimer disease     114213217 (CALML6)    05012 Parkinson disease     114213217 (CALML6)    05022 Pathways of neurodegeneration - multiple diseases     114213217 (CALML6)   09165 Substance dependence    05031 Amphetamine addiction     114213217 (CALML6)    05034 Alcoholism     114213217 (CALML6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114213217 (CALML6)    05418 Fluid shear stress and atherosclerosis     114213217 (CALML6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:eju01009]     114213217 (CALML6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eju04131]     114213217 (CALML6)    03036 Chromosome and associated proteins [BR:eju03036]     114213217 (CALML6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eju04147]     114213217 (CALML6) Protein phosphatases and associated proteins [BR:eju01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114213217 (CALML6) Membrane trafficking [BR:eju04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     114213217 (CALML6) Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      114213217 (CALML6) Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114213217 (CALML6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  114213217 NCBI-ProteinID:  XP_027964093 LinkDB All DBs Position Unknown AA seq 255 aa AA seqDB search MTSGKVTVSGAEPEEWQALRLGRTVVSKKKTPPYRVSPEAAGTQHHGPSASVPSPPAQLM ALKGCQVDVRGGVSCVLGPPPSLRLRGRGGPGEAGPASLQTERLTAEQIKEYKGVFEMFD EEGNGEVKTGELERLMSLLGINPTKSELASMAKDVDRDNKGFFNCDSFLALMGIYWEKAQ NQEGELRAAFRVFDKEGKGYIDWDALKYVLTNAGEPLSEAEAEQMMKEADKDGDGTIDYE EFVAMMTGESFKLVQ NT seq 768 nt NT seq  +upstreamnt  +downstreamnt atgaccagcggaaaggtgaccgtcagtggagcagagcctgaggagtggcaggcattgcga cttggaaggactgtcgtctccaagaaaaagacccctccataccgcgtgtcccctgaggcg gcagggactcaacatcatggcccgagcgccagtgttcccagcccaccggctcagctcatg gccctgaagggttgccaagtggatgtacggggtggggtgtcgtgtgtgctggggcctcca ccctccctcagactgaggggcagaggaggccccggtgaggctgggccggcgtccctgcag acggagcgcctgacagccgagcagatcaaggagtacaagggggtctttgagatgttcgac gaggagggcaacggggaggtgaagactggagagctggagcggctcatgagcctgctgggc atcaatcccaccaagagtgagctggcctccatggccaaggacgtggacagagacaacaaa ggattcttcaactgtgacagcttcctggccctgatggggatttactgggagaaggcccag aaccaggagggcgagctgagggcggcgttccgtgtcttcgacaaggagggcaagggttac atcgactgggacgcgctcaagtacgtgctcacgaacgcaggtgagcccctcagtgaggcc gaggccgagcagatgatgaaggaggctgacaaggacggggatgggaccattgactacgag gagtttgtggccatgatgaccggagagtccttcaagctggtccagtag

DBGET integrated database retrieval system