Eumetopias jubatus (Steller sea lion): 114213562 Help Entry 114213562         CDS       T07240                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04621   NOD-like receptor signaling pathway eju05012   Parkinson disease eju05132   Salmonella infection eju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     114213562 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114213562 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     114213562 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     114213562 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:eju03110]     114213562 (TXN) Chaperones and folding catalysts [BR:eju03110]  Protein folding catalysts   Protein disulfide isomerase    114213562 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_7 Thioredoxin_9 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  114213562 NCBI-ProteinID:  XP_027964618 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNGAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtatgcttttcaggaagccctgaacggtgcaggggat aaacttgtagtagttgacttctcggccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattccctctctgagaagtactccaatgtggtgttccttgaagtagacgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaggaaaaacttgaagccacc ataaatgaattaatctaa

DBGET integrated database retrieval system