Eumetopias jubatus (Steller sea lion): 114213872 Help Entry 114213872         CDS       T07240                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04061   Viral protein interaction with cytokine and cytokine receptor eju04062   Chemokine signaling pathway eju04620   Toll-like receptor signaling pathway eju04621   NOD-like receptor signaling pathway eju04623   Cytosolic DNA-sensing pathway eju04668   TNF signaling pathway eju05020   Prion disease eju05142   Chagas disease eju05163   Human cytomegalovirus infection eju05164   Influenza A eju05168   Herpes simplex virus 1 infection eju05323   Rheumatoid arthritis eju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     114213872 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114213872 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     114213872 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114213872 (CCL5)    04621 NOD-like receptor signaling pathway     114213872 (CCL5)    04623 Cytosolic DNA-sensing pathway     114213872 (CCL5)    04062 Chemokine signaling pathway     114213872 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     114213872 (CCL5)    05168 Herpes simplex virus 1 infection     114213872 (CCL5)    05163 Human cytomegalovirus infection     114213872 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     114213872 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     114213872 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     114213872 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114213872 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114213872 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:eju00536]     114213872 (CCL5) Cytokines and neuropeptides [BR:eju04052]  Cytokines   Chemokines    114213872 (CCL5) Glycosaminoglycan binding proteins [BR:eju00536]  Heparan sulfate / Heparin   Chemokines    114213872 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Ig_NUP210_1st LCE Motif Other DBs NCBI-GeneID:  114213872 NCBI-ProteinID:  XP_027965011 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MSTPAPEEEVEDAIRGGGFPPPVPMLALLEGKEGTDELTLDQRRGSLQRIPRQQVALPEP PPAATFAILLATVAICAPASASPFSSDTTPCCFAYISRRLPFTHIQQYFYTSSKCSMPAV VRSTQRHRQVCANPQKKWVRDHINSLEMS NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgagcacccctgccccagaagaggaagttgaagatgccatcagaggaggaggttttcca ccaccagtgcctatgttagctcttctggagggcaaagaaggaaccgatgagctcactctg gaccagaggcgaggatccctgcagaggatcccaagacagcaggtggctctcccggagcct ccacccgcagctacctttgcaatcctcctggccaccgtcgccatctgcgctcctgcctct gcctcccctttctcctcggacaccacaccctgctgctttgcctacatctcccgccgactg cccttcacccacatccagcagtatttctacaccagcagcaagtgctccatgccagccgtc gtgagaagcacccagaggcaccgccaggtgtgtgccaacccacagaagaaatgggtgcgg gaccacatcaactctttggagatgagttag

DBGET integrated database retrieval system