Eumetopias jubatus (Steller sea lion): 114213892 Help Entry 114213892         CDS       T07240                                  Name (RefSeq) C-C motif chemokine 13-like   KO K16595   C-C motif chemokine 13 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04061   Viral protein interaction with cytokine and cytokine receptor eju04062   Chemokine signaling pathway eju04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     114213892   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114213892    04061 Viral protein interaction with cytokine and cytokine receptor     114213892  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     114213892  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114213892    00536 Glycosaminoglycan binding proteins [BR:eju00536]     114213892 Cytokines and neuropeptides [BR:eju04052]  Cytokines   Chemokines    114213892 Glycosaminoglycan binding proteins [BR:eju00536]  Heparan sulfate / Heparin   Chemokines    114213892 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  114213892 NCBI-ProteinID:  XP_027965022 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MKVSATLLYLLLTAAAFSPQVLAQPDALSALFTCCFTFNNKKIPLRKLESYRITSSHCPR QAVIFRTKLAKAICANPKEKWVQDYVKHLDQKPHTLRT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgccacgcttctgtacctgctgctcacagccgccgccttcagcccccag gtgctcgcccagccggatgcactcagcgccctattcacttgctgtttcacatttaacaat aagaagatccccttgcggaagctggagagctatcgaatcaccagcagccactgtccccgg caagctgtcatcttcaggacgaaactagccaaggccatctgtgccaacccaaaggagaag tgggtccaggattatgtgaaacacctcgatcaaaaacctcataccctgcggacttga

DBGET integrated database retrieval system