Eumetopias jubatus (Steller sea lion): 114214020 Help Entry 114214020         CDS       T07240                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04061   Viral protein interaction with cytokine and cytokine receptor eju04062   Chemokine signaling pathway eju04064   NF-kappa B signaling pathway eju04620   Toll-like receptor signaling pathway eju04623   Cytosolic DNA-sensing pathway eju05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     114214020   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114214020    04061 Viral protein interaction with cytokine and cytokine receptor     114214020  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114214020    04623 Cytosolic DNA-sensing pathway     114214020    04062 Chemokine signaling pathway     114214020  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     114214020  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114214020 Cytokines and neuropeptides [BR:eju04052]  Cytokines   Chemokines    114214020 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  114214020 NCBI-ProteinID:  XP_027965246 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MKLCVTVLPLLALMAAFCSPALSAPMGSDPPTACCFSYTLRQLPRNFVTDYFETSSLCSQ PAVVFQTKRGRQVCANPSEPWVQEYMNDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctgtgtgtgactgtccttcctctccttgcgctcatggctgccttctgctccccg gcgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccctg aggcagctccctcgcaactttgtgaccgattacttcgagaccagcagcctctgctcccag ccagccgtggtattccaaaccaaaaggggcagacaagtgtgtgctaaccccagtgagccc tgggtccaggaatacatgaatgatctggaactgaactga

DBGET integrated database retrieval system