KEGG   Eumetopias jubatus (Steller sea lion): 114214336
Entry
114214336         CDS       T07240                                 
Name
(RefSeq) integrin alpha-X-like isoform X1
  KO
K06462  integrin alpha X
Organism
eju  Eumetopias jubatus (Steller sea lion)
Pathway
eju04610  Complement and coagulation cascades
eju04810  Regulation of actin cytoskeleton
eju05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:eju00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114214336
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    114214336
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    114214336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:eju04515]
    114214336
   04090 CD molecules [BR:eju04090]
    114214336
Cell adhesion molecules [BR:eju04515]
 Integrins
  Integrin alpha subunits
   114214336
CD molecules [BR:eju04090]
 Proteins
  114214336
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2 VWA_CoxE EF-hand_1
Other DBs
NCBI-GeneID: 114214336
NCBI-ProteinID: XP_027965697
LinkDB
Position
Unknown
AA seq 1166 aa
MSDLPVMTRTRTSLLLLMALASSLCFNLDTDQPKTFLMDSAGFGHSVVQYGNTWVVVGAP
QEIKAANQTGSLYQCDYSMGKCEPIHLQIPPEAVNMSLGLTLAASTNPSQLLACGPTVHH
TCQENMYLTGFCFLLGSSSWQTQRLPAALQECPKQEQDIVFLIDGSGSISFHDFRKMLNF
VKAVMRQFQRPNTQFSLVQFSNTFRVHFTFKDFTYSSNPLILLDSVRQLGGYTHTATAIQ
KVTNELFSTSGGARKDASKILIVITDGQKQGDRLGYEDVIPMAEAAGIIRYAVGVGSAFQ
KKHSWKELNDIASKPSHEYIFKVENFDALRDIQNQLKEKIFAIEGTQTISSISFELEMSQ
EGFSAVFIPDGPVLGAVGSFSWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELAL
WKGVQSLILGAPRHQHTGKVVIFTQASGQWRPKAEVAGTQIGSYFGASLCTVDVDRDGSS
DLVLIGAPHYYKPTQGGQVSVCPLPQGRAKWQCEVILCGEQGHPWGRFGAALTVLGDVNG
DKLTDVAIGAPGEQESRGAVYLFHGTSGLGISTSHSQRISAYQLSPSLQYFGQSLSGGQD
LTLDGLVDLAVGAHGQVLLLRTRPVLRVWMSIRFKPAEIAKSLFECREETSSVNALGDAN
VCLHIYESPKNRLGDLQSSVTYDLTLDPGRQSPRAIFEETKTWNLTRVRVLGLRQHCETV
KLLLLACVEDSVTPITLRLNFSLVGKPIPSFGSLRPMLAVDAQRYYTASLPFEKNCGTDH
VCQDDLGISFGFSGLKTLLVGSTLEMNMKVMVWNDGEDSYGTTVTFFYPPGLSYRRVAVS
KSQLQPHSPHLTCDGIPAQGQGIQSTRCSINHLILPEGAQVTFLVTFDVSPKAMLGDRLL
LTANVSSENNTPRTSKSTFQMELMVKYAIYTVISSHEQSTKYLNFSASDQEESNQAQHRY
QVNNLGQRDLPISIIFSVPVELNGVPVWRELEVFHPQNPSIQCSSERIVHRESDFLTHIQ
KNSVLDCSTADCLRFCCDLPSFGIQEELDFILKGNLSFGWVSQTLQKKVLVVSVAEITFN
RSVYSQLPGQEAFLRAQVETVLEKYEVYNPIPIIVGSSVGGLLLLALITAILYKVGFFKR
QYKEMMAEADGQTVPENGTSDPQVAQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtctgaccttccagtcatgaccaggaccagaacatccctcctcctgttgatggccttg
gcttcttctctctgcttcaacttggacacagaccagccaaaaaccttccttatggacagt
gctggatttggacacagcgtggtccagtatggcaatacctgggtggtggttggagccccc
caggagataaaggctgccaaccaaacaggcagcctctaccagtgtgactacagcatgggc
aagtgtgagcccatccacttgcagattcccccagaagctgtgaacatgtccctgggactg
accctggcagcctccactaacccctctcagttgctggcctgtggccccacagtgcaccat
acatgccaggagaacatgtacttgactgggttctgcttcctgctgggctcctcttcctgg
caaacccagaggctcccagctgccctgcaggaatgtccaaagcaagagcaagatattgtg
ttcctgatcgacggctcaggcagcatctcattccatgattttagaaagatgctgaatttt
gtgaaggctgtgatgagacagttccagagacctaacacccagttctccctggtgcagttt
tccaacactttccgggtgcacttcactttcaaagacttcacatacagctcaaacccactc
atcctgttggattctgtacgccagctgggagggtatactcacacagccacagccatccaa
aaagtcacaaacgaactgttcagtacctcaggaggggcccgaaaagatgcctccaagatc
ctcattgtcatcaccgatgggcaaaaacaaggcgaccgcctgggttatgaggatgtcatc
cctatggctgaggctgcgggtatcatccgttatgcagttggggtgggatcggcttttcaa
aagaaacattcctggaaagaattaaatgacattgcatcgaagccctcccatgagtacatt
tttaaagtggagaattttgatgctttgagagacattcaaaaccaactgaaagagaagatc
tttgccattgagggtacacagacaataagcagtatttcctttgaattggagatgtcccag
gagggcttcagcgctgtgttcatacctgatggaccagttctgggggcagtggggagcttc
agctggtctggaggtgccttcctgtaccccccaaatatgagccccactttcatcaacatg
tctcaagagaatgtggacatgagggactcttacctgggttactccactgagttggctctt
tggaagggggtccagagcctgatcttgggggccccccgccatcaacatactgggaaggtt
gtcatcttcacccaggcatctgggcaatggaggccgaaggctgaagtcgcagggactcag
attggctcctactttggggcctccctctgcactgtggatgtggatagagatggcagctct
gaccttgtcctcattggggctccccattactacaagccaacccaggggggccaggtgtct
gtgtgccccttgccccaagggagggctaagtggcagtgtgaggtcattctctgtggggag
cagggccacccctggggccgctttggggcagccctgacggtgctgggggatgtgaatggg
gacaagctgacagacgtggccattggggccccaggagagcaggagagccggggtgctgtc
tacctatttcatggaacctcaggactgggcatcagcacctcccacagtcagaggatctca
gcctaccagctctcccccagcctccagtattttgggcagtcactgagtgggggtcaggac
cttaccctggatggactggtggacctggccgtgggggcccatgggcaggtgctgctgctc
aggaccagacctgtactcagggtgtggatgagcatccgattcaaacctgcagagatagcc
aagtctctgtttgagtgtcgggaggagacctcctctgtcaatgcactgggcgatgccaat
gtctgtcttcatatttatgaaagtcccaagaatcggctgggtgacctccaaagctctgtg
acctatgacctgaccctcgacccaggccgccagagtcctcgtgccatctttgaggagaca
aagacctggaatctgactcgtgtccgagtccttgggctgagacagcactgtgagactgtg
aagttgcttctcctggcctgtgtggaggactcagtgacccccatcaccttgcgtctcaac
ttctccctagtgggcaagcctatcccttcctttggaagcctccggcctatgttggctgtg
gatgctcagagatactacacagcctctctcccctttgagaagaattgtggaactgaccat
gtctgccaggatgaccttggcatctcctttggcttctcaggcttgaagacgctcttggtg
gggagtaccctggagatgaatatgaaagtgatggtttggaatgatggtgaggactcctat
ggaaccacagtcaccttcttctacccaccagggctgtcttatcgacgtgtggcagtgagc
aagagccagctgcagccacactccccacacctgacctgtgatggcatcccagcccagggc
cagggtattcagagcacccgctgcagcatcaaccacctcatcctccctgagggtgcccag
gtcaccttcttggtcacctttgatgtctcccccaaggccatgctgggagaccggctgctt
ctgacagctaatgtgagcagtgaaaataacactcccaggaccagcaagagcacctttcag
atggagctcatggtgaagtatgccatctacaccgtgatcagcagccatgaacagtccacc
aagtacctcaacttctcagcctcagaccaggaggaaagcaaccaggctcagcatagatac
caggtgaacaacctgggacagagggacctgcctatcagcatcatcttctctgttcctgtg
gaactgaatggggtacctgtgtggagagaattagaggtcttccacccccagaatccctcc
attcagtgttcttcagagagaatagtgcacagagagtctgacttcctgacccacattcag
aaaaattctgtgctggactgctccactgctgactgtctgaggttctgctgtgacctcccc
tcctttggcattcaggaggaacttgacttcatcttgaagggcaacctcagttttggttgg
gtcagccagacattgcagaagaaggtattagtggtgagtgtggctgaaatcacattcaac
agatccgtgtattcccagcttccaggacaggaggcattcttgagagctcaggtggagaca
gtgctggagaagtatgaggtctacaaccccatccccattattgtgggcagctctgtggga
gggctgctgctgctggctctcatcacagccatcctatacaaggttggcttcttcaaacgt
cagtataaggaaatgatggcggaagccgatgggcagactgtcccagaaaatgggacttca
gaccctcaagttgcccaataa

DBGET integrated database retrieval system