KEGG   Eumetopias jubatus (Steller sea lion): 114214409
Entry
114214409         CDS       T07240                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
eju  Eumetopias jubatus (Steller sea lion)
Pathway
eju01521  EGFR tyrosine kinase inhibitor resistance
eju01522  Endocrine resistance
eju01524  Platinum drug resistance
eju04010  MAPK signaling pathway
eju04012  ErbB signaling pathway
eju04014  Ras signaling pathway
eju04015  Rap1 signaling pathway
eju04022  cGMP-PKG signaling pathway
eju04024  cAMP signaling pathway
eju04062  Chemokine signaling pathway
eju04066  HIF-1 signaling pathway
eju04068  FoxO signaling pathway
eju04071  Sphingolipid signaling pathway
eju04072  Phospholipase D signaling pathway
eju04114  Oocyte meiosis
eju04140  Autophagy - animal
eju04148  Efferocytosis
eju04150  mTOR signaling pathway
eju04151  PI3K-Akt signaling pathway
eju04210  Apoptosis
eju04218  Cellular senescence
eju04261  Adrenergic signaling in cardiomyocytes
eju04270  Vascular smooth muscle contraction
eju04350  TGF-beta signaling pathway
eju04360  Axon guidance
eju04370  VEGF signaling pathway
eju04371  Apelin signaling pathway
eju04380  Osteoclast differentiation
eju04510  Focal adhesion
eju04517  IgSF CAM signaling
eju04520  Adherens junction
eju04540  Gap junction
eju04550  Signaling pathways regulating pluripotency of stem cells
eju04611  Platelet activation
eju04613  Neutrophil extracellular trap formation
eju04620  Toll-like receptor signaling pathway
eju04621  NOD-like receptor signaling pathway
eju04625  C-type lectin receptor signaling pathway
eju04650  Natural killer cell mediated cytotoxicity
eju04657  IL-17 signaling pathway
eju04658  Th1 and Th2 cell differentiation
eju04659  Th17 cell differentiation
eju04660  T cell receptor signaling pathway
eju04662  B cell receptor signaling pathway
eju04664  Fc epsilon RI signaling pathway
eju04666  Fc gamma R-mediated phagocytosis
eju04668  TNF signaling pathway
eju04713  Circadian entrainment
eju04720  Long-term potentiation
eju04722  Neurotrophin signaling pathway
eju04723  Retrograde endocannabinoid signaling
eju04724  Glutamatergic synapse
eju04725  Cholinergic synapse
eju04726  Serotonergic synapse
eju04730  Long-term depression
eju04810  Regulation of actin cytoskeleton
eju04910  Insulin signaling pathway
eju04912  GnRH signaling pathway
eju04914  Progesterone-mediated oocyte maturation
eju04915  Estrogen signaling pathway
eju04916  Melanogenesis
eju04917  Prolactin signaling pathway
eju04919  Thyroid hormone signaling pathway
eju04921  Oxytocin signaling pathway
eju04926  Relaxin signaling pathway
eju04928  Parathyroid hormone synthesis, secretion and action
eju04929  GnRH secretion
eju04930  Type II diabetes mellitus
eju04933  AGE-RAGE signaling pathway in diabetic complications
eju04934  Cushing syndrome
eju04935  Growth hormone synthesis, secretion and action
eju04960  Aldosterone-regulated sodium reabsorption
eju05010  Alzheimer disease
eju05020  Prion disease
eju05022  Pathways of neurodegeneration - multiple diseases
eju05034  Alcoholism
eju05132  Salmonella infection
eju05133  Pertussis
eju05135  Yersinia infection
eju05140  Leishmaniasis
eju05142  Chagas disease
eju05145  Toxoplasmosis
eju05152  Tuberculosis
eju05160  Hepatitis C
eju05161  Hepatitis B
eju05163  Human cytomegalovirus infection
eju05164  Influenza A
eju05165  Human papillomavirus infection
eju05166  Human T-cell leukemia virus 1 infection
eju05167  Kaposi sarcoma-associated herpesvirus infection
eju05170  Human immunodeficiency virus 1 infection
eju05171  Coronavirus disease - COVID-19
eju05200  Pathways in cancer
eju05203  Viral carcinogenesis
eju05205  Proteoglycans in cancer
eju05206  MicroRNAs in cancer
eju05207  Chemical carcinogenesis - receptor activation
eju05208  Chemical carcinogenesis - reactive oxygen species
eju05210  Colorectal cancer
eju05211  Renal cell carcinoma
eju05212  Pancreatic cancer
eju05213  Endometrial cancer
eju05214  Glioma
eju05215  Prostate cancer
eju05216  Thyroid cancer
eju05218  Melanoma
eju05219  Bladder cancer
eju05220  Chronic myeloid leukemia
eju05221  Acute myeloid leukemia
eju05223  Non-small cell lung cancer
eju05224  Breast cancer
eju05225  Hepatocellular carcinoma
eju05226  Gastric cancer
eju05230  Central carbon metabolism in cancer
eju05231  Choline metabolism in cancer
eju05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
eju05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:eju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114214409 (MAPK3)
   04012 ErbB signaling pathway
    114214409 (MAPK3)
   04014 Ras signaling pathway
    114214409 (MAPK3)
   04015 Rap1 signaling pathway
    114214409 (MAPK3)
   04350 TGF-beta signaling pathway
    114214409 (MAPK3)
   04370 VEGF signaling pathway
    114214409 (MAPK3)
   04371 Apelin signaling pathway
    114214409 (MAPK3)
   04668 TNF signaling pathway
    114214409 (MAPK3)
   04066 HIF-1 signaling pathway
    114214409 (MAPK3)
   04068 FoxO signaling pathway
    114214409 (MAPK3)
   04072 Phospholipase D signaling pathway
    114214409 (MAPK3)
   04071 Sphingolipid signaling pathway
    114214409 (MAPK3)
   04024 cAMP signaling pathway
    114214409 (MAPK3)
   04022 cGMP-PKG signaling pathway
    114214409 (MAPK3)
   04151 PI3K-Akt signaling pathway
    114214409 (MAPK3)
   04150 mTOR signaling pathway
    114214409 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    114214409 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114214409 (MAPK3)
   04148 Efferocytosis
    114214409 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    114214409 (MAPK3)
   04210 Apoptosis
    114214409 (MAPK3)
   04218 Cellular senescence
    114214409 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114214409 (MAPK3)
   04520 Adherens junction
    114214409 (MAPK3)
   04540 Gap junction
    114214409 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    114214409 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114214409 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    114214409 (MAPK3)
   04613 Neutrophil extracellular trap formation
    114214409 (MAPK3)
   04620 Toll-like receptor signaling pathway
    114214409 (MAPK3)
   04621 NOD-like receptor signaling pathway
    114214409 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    114214409 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    114214409 (MAPK3)
   04660 T cell receptor signaling pathway
    114214409 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    114214409 (MAPK3)
   04659 Th17 cell differentiation
    114214409 (MAPK3)
   04657 IL-17 signaling pathway
    114214409 (MAPK3)
   04662 B cell receptor signaling pathway
    114214409 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    114214409 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    114214409 (MAPK3)
   04062 Chemokine signaling pathway
    114214409 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114214409 (MAPK3)
   04929 GnRH secretion
    114214409 (MAPK3)
   04912 GnRH signaling pathway
    114214409 (MAPK3)
   04915 Estrogen signaling pathway
    114214409 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    114214409 (MAPK3)
   04917 Prolactin signaling pathway
    114214409 (MAPK3)
   04921 Oxytocin signaling pathway
    114214409 (MAPK3)
   04926 Relaxin signaling pathway
    114214409 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    114214409 (MAPK3)
   04919 Thyroid hormone signaling pathway
    114214409 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    114214409 (MAPK3)
   04916 Melanogenesis
    114214409 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114214409 (MAPK3)
   04270 Vascular smooth muscle contraction
    114214409 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    114214409 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    114214409 (MAPK3)
   04725 Cholinergic synapse
    114214409 (MAPK3)
   04726 Serotonergic synapse
    114214409 (MAPK3)
   04720 Long-term potentiation
    114214409 (MAPK3)
   04730 Long-term depression
    114214409 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    114214409 (MAPK3)
   04722 Neurotrophin signaling pathway
    114214409 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    114214409 (MAPK3)
   04380 Osteoclast differentiation
    114214409 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    114214409 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114214409 (MAPK3)
   05206 MicroRNAs in cancer
    114214409 (MAPK3)
   05205 Proteoglycans in cancer
    114214409 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    114214409 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    114214409 (MAPK3)
   05203 Viral carcinogenesis
    114214409 (MAPK3)
   05230 Central carbon metabolism in cancer
    114214409 (MAPK3)
   05231 Choline metabolism in cancer
    114214409 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114214409 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    114214409 (MAPK3)
   05212 Pancreatic cancer
    114214409 (MAPK3)
   05225 Hepatocellular carcinoma
    114214409 (MAPK3)
   05226 Gastric cancer
    114214409 (MAPK3)
   05214 Glioma
    114214409 (MAPK3)
   05216 Thyroid cancer
    114214409 (MAPK3)
   05221 Acute myeloid leukemia
    114214409 (MAPK3)
   05220 Chronic myeloid leukemia
    114214409 (MAPK3)
   05218 Melanoma
    114214409 (MAPK3)
   05211 Renal cell carcinoma
    114214409 (MAPK3)
   05219 Bladder cancer
    114214409 (MAPK3)
   05215 Prostate cancer
    114214409 (MAPK3)
   05213 Endometrial cancer
    114214409 (MAPK3)
   05224 Breast cancer
    114214409 (MAPK3)
   05223 Non-small cell lung cancer
    114214409 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114214409 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    114214409 (MAPK3)
   05161 Hepatitis B
    114214409 (MAPK3)
   05160 Hepatitis C
    114214409 (MAPK3)
   05171 Coronavirus disease - COVID-19
    114214409 (MAPK3)
   05164 Influenza A
    114214409 (MAPK3)
   05163 Human cytomegalovirus infection
    114214409 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114214409 (MAPK3)
   05165 Human papillomavirus infection
    114214409 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114214409 (MAPK3)
   05135 Yersinia infection
    114214409 (MAPK3)
   05133 Pertussis
    114214409 (MAPK3)
   05152 Tuberculosis
    114214409 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    114214409 (MAPK3)
   05140 Leishmaniasis
    114214409 (MAPK3)
   05142 Chagas disease
    114214409 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114214409 (MAPK3)
   05020 Prion disease
    114214409 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    114214409 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    114214409 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114214409 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    114214409 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    114214409 (MAPK3)
   04934 Cushing syndrome
    114214409 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114214409 (MAPK3)
   01524 Platinum drug resistance
    114214409 (MAPK3)
   01522 Endocrine resistance
    114214409 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eju01001]
    114214409 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eju03036]
    114214409 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eju04147]
    114214409 (MAPK3)
Enzymes [BR:eju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114214409 (MAPK3)
Protein kinases [BR:eju01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   114214409 (MAPK3)
Chromosome and associated proteins [BR:eju03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     114214409 (MAPK3)
Exosome [BR:eju04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114214409 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 114214409
NCBI-ProteinID: XP_027965836
LinkDB
Position
Unknown
AA seq 371 aa
GGGGEPRGADGVGPGVSGEVEVVKGQPFDVGPRYTELHYIGEGAYGMVSSAYDHVRKIRV
AIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETD
LYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLA
RIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLD
RMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQET
ARFQPGALEAP
NT seq 1116 nt   +upstreamnt  +downstreamnt
gggggggggggggagccccggggagctgatggggtcggcccgggggtctcgggggaggtg
gaggtagtgaaggggcagccgttcgacgtgggcccccgctacacggagctgcattacatc
ggcgagggcgcgtacggcatggtcagctcagcttacgaccacgtgcgcaagattcgcgtg
gccatcaagaaaatcagccccttcgagcatcagacctactgccagcgcacactgcgcgag
attcagatcttgctgcgcttccgccatgagaacgtcattggcattcgggacattctgcgg
gcgcccaccctggaagccatgagggatgtctacatcgtgcaggacctgatggagacagac
ctctacaagttgctgaaaagccagcagctgagcaacgaccatgtttgctacttcctctac
cagatccttcgaggcctcaagtatatccactcagccaacgtgctccaccgggatttaaag
ccctctaacctgctcatcaacaccacctgcgaccttaagatctgcgattttggcctggcc
cggattgccgatcccgagcatgaccacactggcttcctgacagaatatgtggccacacgc
tggtaccgggctccagaaatcatgcttaactctaagggctacaccaagtccatcgacatc
tggtctgtgggctgcattctggctgagatgctctccaaccggcccatcttccctggcaag
cactacctggaccagctcaaccacattctgggtatcctgggctccccatcccaggaggac
ttgaattgtatcatcaatatgaaggcccgaaactacctgcagtctctgccctccaagacc
aaggtggcctgggccaagctttttcccaagtcagactccaaagcccttgacctgctagac
cggatgttgacctttaaccccaacaaacggatcacagtggaagaagcgctggctcacccc
tacttggagcagtactacgacccaacagatgagccagtggctgaggagcctttcaccttc
gacatggagctggatgatctacccaaggaacggctgaaggagctcatcttccaagagaca
gcccgcttccagcctggggcactggaggccccctaa

DBGET integrated database retrieval system