Eumetopias jubatus (Steller sea lion): 114214449 Help Entry 114214449         CDS       T07240                                  Symbol CCL24 Name (RefSeq) C-C motif chemokine 24   KO K21097   C-C motif chemokine 24 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04061   Viral protein interaction with cytokine and cytokine receptor eju04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114214449 (CCL24)    04061 Viral protein interaction with cytokine and cytokine receptor     114214449 (CCL24)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     114214449 (CCL24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114214449 (CCL24) Cytokines and neuropeptides [BR:eju04052]  Cytokines   Chemokines    114214449 (CCL24) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  114214449 NCBI-ProteinID:  XP_027965911 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MAGLVTLGASLLLLSLCAHRIDPAGSVPIPSSCCLSFISKKVPENRVVSYQRSSASVCPV TGVIFTTRKGQKFCGDPRQHWVQKYMKKLDARRKTASPGVRAMSTKAPVQGYPANTTSI NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcaggccttgtgacccttggggctagcctcctgcttctgagcctatgtgcccaccgc attgaccctgcaggctctgtgcccatcccctcttcctgctgcctgtccttcatttccaag aaagttcccgagaaccgagtggttagctaccagcggtccagtgcgagcgtctgccctgtg acaggcgtgatcttcaccaccaggaaaggccagaagttctgtggcgaccccaggcagcac tgggtccagaagtacatgaagaagctggatgccaggcggaagacggcgtcccctggggtc agagcaatgagcaccaaagccccagtgcaggggtacccggccaacaccacctccatctaa

DBGET integrated database retrieval system