Eumetopias jubatus (Steller sea lion): 114214570 Help Entry 114214570         CDS       T07240                                  Symbol MYL10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04510   Focal adhesion eju04520   Adherens junction eju04670   Leukocyte transendothelial migration eju04810   Regulation of actin cytoskeleton eju04814   Motor proteins eju05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eju00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     114214570 (MYL10)    04520 Adherens junction     114214570 (MYL10)   09142 Cell motility    04814 Motor proteins     114214570 (MYL10)    04810 Regulation of actin cytoskeleton     114214570 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     114214570 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114214570 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:eju04812]     114214570 (MYL10) Cytoskeleton proteins [BR:eju04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      114214570 (MYL10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 EF_EFCAB10_C AIF-1 Motif Other DBs NCBI-GeneID:  114214570 NCBI-ProteinID:  XP_027966121 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MAPRRARKRAEGGAGSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRI NVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTAGKGFVKADFI KEKLMTQADRFSEEEVKQMFAAFPPDMCGNLDYRNLCYVITHGEEKD NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atggcacccagaagagcccgcaagagagccgaaggtggagccggctccaatgtcttctcc atgtttgatcagtcccagatccaggagtttaaagaggccttcaccatcatggaccagaac cgggatggcttcatcgacaaggaggacctgagggatacctttgctgccttgggccgcatc aatgtgaagaacgaggagctggaggccatggtgaaggaggcccccgggcccatcaacttc accgtcttcctgaccatgtttggggagaagctgaagggtacggacccggaggagaccatt ctccacgccttcaaggtgtttgacaccgcagggaaaggtttcgtcaaggctgatttcatc aaagagaagctcatgacccaggccgaccggttcagtgaggaggaggtcaagcagatgttt gcggctttcccgccagatatgtgtggtaacctggattaccggaacctgtgctacgtcatc acacacggagaggagaaagactag

DBGET integrated database retrieval system