Eumetopias jubatus (Steller sea lion): 114215667 Help Entry 114215667         CDS       T07240                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04066   HIF-1 signaling pathway eju04120   Ubiquitin mediated proteolysis eju05170   Human immunodeficiency virus 1 infection eju05200   Pathways in cancer eju05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:eju00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114215667 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     114215667 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114215667 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     114215667 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     114215667 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:eju04121]     114215667 (ELOB)    03400 DNA repair and recombination proteins [BR:eju03400]     114215667 (ELOB) Ubiquitin system [BR:eju04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      114215667 (ELOB)    Cul5 complex      114215667 (ELOB) DNA repair and recombination proteins [BR:eju03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      114215667 (ELOB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  114215667 NCBI-ProteinID:  XP_027967609 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADEAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttccttatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagcactgtgttcgagctgaagcgcatcgtcgagggcatcctcaagcggccgcccgac gagcagcggctgtacaaggatgaccagcttctggatgacggcaagacactgggagagtgt ggcttcaccagtcagacagcacggccgcaggccccagccactgtagggctggcctttcga gcagatgaagctttcgaggccctgcgcatcgagcccttctccagcccacctgagctgccc gatgtgatgaagccacaggactcaggaagcagcgccaatgaacaagcggtgcagtga

DBGET integrated database retrieval system