Eumetopias jubatus (Steller sea lion): 114216180 Help Entry 114216180         CDS       T07240                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04613   Neutrophil extracellular trap formation eju05034   Alcoholism eju05202   Transcriptional misregulation in cancer eju05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:eju00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114216180  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     114216180   09163 Immune disease    05322 Systemic lupus erythematosus     114216180   09165 Substance dependence    05034 Alcoholism     114216180  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eju03036]     114216180   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eju04147]     114216180 Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114216180 Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114216180 SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  114216180 NCBI-ProteinID:  XP_027968403 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgaaccaagcagactgcccgtaaatccacgggtgggaaagcgccccgcaaacag ctggccactaaagccgcccggaaaagcgccccgtctaccggtggggtgaaaaaacctcat cgctacaggcccgggaccgtagcgcttcgggagattcgtcgttaccagaaatccaccgag cttctgatccggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa accgatctgaggtttcagagcgccgccattggtgcgcttcaggaggccagtgaagcgtac ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system