KEGG   Eumetopias jubatus (Steller sea lion): 114216565
Entry
114216565         CDS       T07240                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
eju  Eumetopias jubatus (Steller sea lion)
Pathway
eju01521  EGFR tyrosine kinase inhibitor resistance
eju01522  Endocrine resistance
eju04010  MAPK signaling pathway
eju04012  ErbB signaling pathway
eju04014  Ras signaling pathway
eju04015  Rap1 signaling pathway
eju04062  Chemokine signaling pathway
eju04068  FoxO signaling pathway
eju04071  Sphingolipid signaling pathway
eju04072  Phospholipase D signaling pathway
eju04137  Mitophagy - animal
eju04140  Autophagy - animal
eju04150  mTOR signaling pathway
eju04151  PI3K-Akt signaling pathway
eju04210  Apoptosis
eju04211  Longevity regulating pathway
eju04213  Longevity regulating pathway - multiple species
eju04218  Cellular senescence
eju04360  Axon guidance
eju04370  VEGF signaling pathway
eju04371  Apelin signaling pathway
eju04540  Gap junction
eju04550  Signaling pathways regulating pluripotency of stem cells
eju04625  C-type lectin receptor signaling pathway
eju04650  Natural killer cell mediated cytotoxicity
eju04660  T cell receptor signaling pathway
eju04662  B cell receptor signaling pathway
eju04664  Fc epsilon RI signaling pathway
eju04714  Thermogenesis
eju04720  Long-term potentiation
eju04722  Neurotrophin signaling pathway
eju04725  Cholinergic synapse
eju04726  Serotonergic synapse
eju04730  Long-term depression
eju04810  Regulation of actin cytoskeleton
eju04910  Insulin signaling pathway
eju04912  GnRH signaling pathway
eju04914  Progesterone-mediated oocyte maturation
eju04915  Estrogen signaling pathway
eju04916  Melanogenesis
eju04917  Prolactin signaling pathway
eju04919  Thyroid hormone signaling pathway
eju04921  Oxytocin signaling pathway
eju04926  Relaxin signaling pathway
eju04929  GnRH secretion
eju04933  AGE-RAGE signaling pathway in diabetic complications
eju04935  Growth hormone synthesis, secretion and action
eju04960  Aldosterone-regulated sodium reabsorption
eju05010  Alzheimer disease
eju05022  Pathways of neurodegeneration - multiple diseases
eju05034  Alcoholism
eju05160  Hepatitis C
eju05161  Hepatitis B
eju05163  Human cytomegalovirus infection
eju05165  Human papillomavirus infection
eju05166  Human T-cell leukemia virus 1 infection
eju05167  Kaposi sarcoma-associated herpesvirus infection
eju05170  Human immunodeficiency virus 1 infection
eju05200  Pathways in cancer
eju05203  Viral carcinogenesis
eju05205  Proteoglycans in cancer
eju05206  MicroRNAs in cancer
eju05207  Chemical carcinogenesis - receptor activation
eju05208  Chemical carcinogenesis - reactive oxygen species
eju05210  Colorectal cancer
eju05211  Renal cell carcinoma
eju05212  Pancreatic cancer
eju05213  Endometrial cancer
eju05214  Glioma
eju05215  Prostate cancer
eju05216  Thyroid cancer
eju05218  Melanoma
eju05219  Bladder cancer
eju05220  Chronic myeloid leukemia
eju05221  Acute myeloid leukemia
eju05223  Non-small cell lung cancer
eju05224  Breast cancer
eju05225  Hepatocellular carcinoma
eju05226  Gastric cancer
eju05230  Central carbon metabolism in cancer
eju05231  Choline metabolism in cancer
eju05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
eju05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:eju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114216565 (KRAS)
   04012 ErbB signaling pathway
    114216565 (KRAS)
   04014 Ras signaling pathway
    114216565 (KRAS)
   04015 Rap1 signaling pathway
    114216565 (KRAS)
   04370 VEGF signaling pathway
    114216565 (KRAS)
   04371 Apelin signaling pathway
    114216565 (KRAS)
   04068 FoxO signaling pathway
    114216565 (KRAS)
   04072 Phospholipase D signaling pathway
    114216565 (KRAS)
   04071 Sphingolipid signaling pathway
    114216565 (KRAS)
   04151 PI3K-Akt signaling pathway
    114216565 (KRAS)
   04150 mTOR signaling pathway
    114216565 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114216565 (KRAS)
   04137 Mitophagy - animal
    114216565 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    114216565 (KRAS)
   04218 Cellular senescence
    114216565 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114216565 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    114216565 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114216565 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114216565 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    114216565 (KRAS)
   04660 T cell receptor signaling pathway
    114216565 (KRAS)
   04662 B cell receptor signaling pathway
    114216565 (KRAS)
   04664 Fc epsilon RI signaling pathway
    114216565 (KRAS)
   04062 Chemokine signaling pathway
    114216565 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114216565 (KRAS)
   04929 GnRH secretion
    114216565 (KRAS)
   04912 GnRH signaling pathway
    114216565 (KRAS)
   04915 Estrogen signaling pathway
    114216565 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    114216565 (KRAS)
   04917 Prolactin signaling pathway
    114216565 (KRAS)
   04921 Oxytocin signaling pathway
    114216565 (KRAS)
   04926 Relaxin signaling pathway
    114216565 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    114216565 (KRAS)
   04919 Thyroid hormone signaling pathway
    114216565 (KRAS)
   04916 Melanogenesis
    114216565 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    114216565 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    114216565 (KRAS)
   04726 Serotonergic synapse
    114216565 (KRAS)
   04720 Long-term potentiation
    114216565 (KRAS)
   04730 Long-term depression
    114216565 (KRAS)
   04722 Neurotrophin signaling pathway
    114216565 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    114216565 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    114216565 (KRAS)
   04213 Longevity regulating pathway - multiple species
    114216565 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    114216565 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114216565 (KRAS)
   05206 MicroRNAs in cancer
    114216565 (KRAS)
   05205 Proteoglycans in cancer
    114216565 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    114216565 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    114216565 (KRAS)
   05203 Viral carcinogenesis
    114216565 (KRAS)
   05230 Central carbon metabolism in cancer
    114216565 (KRAS)
   05231 Choline metabolism in cancer
    114216565 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114216565 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    114216565 (KRAS)
   05212 Pancreatic cancer
    114216565 (KRAS)
   05225 Hepatocellular carcinoma
    114216565 (KRAS)
   05226 Gastric cancer
    114216565 (KRAS)
   05214 Glioma
    114216565 (KRAS)
   05216 Thyroid cancer
    114216565 (KRAS)
   05221 Acute myeloid leukemia
    114216565 (KRAS)
   05220 Chronic myeloid leukemia
    114216565 (KRAS)
   05218 Melanoma
    114216565 (KRAS)
   05211 Renal cell carcinoma
    114216565 (KRAS)
   05219 Bladder cancer
    114216565 (KRAS)
   05215 Prostate cancer
    114216565 (KRAS)
   05213 Endometrial cancer
    114216565 (KRAS)
   05224 Breast cancer
    114216565 (KRAS)
   05223 Non-small cell lung cancer
    114216565 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114216565 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    114216565 (KRAS)
   05161 Hepatitis B
    114216565 (KRAS)
   05160 Hepatitis C
    114216565 (KRAS)
   05163 Human cytomegalovirus infection
    114216565 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114216565 (KRAS)
   05165 Human papillomavirus infection
    114216565 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114216565 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    114216565 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    114216565 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114216565 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    114216565 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114216565 (KRAS)
   01522 Endocrine resistance
    114216565 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eju04131]
    114216565 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:eju04031]
    114216565 (KRAS)
Membrane trafficking [BR:eju04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    114216565 (KRAS)
GTP-binding proteins [BR:eju04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    114216565 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha ATP_bind_1 FeoB_N Septin DUF6974
Other DBs
NCBI-GeneID: 114216565
NCBI-ProteinID: XP_027968966
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKINKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacaatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcttttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcaacaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

DBGET integrated database retrieval system