Eumetopias jubatus (Steller sea lion): 114219703 Help Entry 114219703         CDS       T07240                                  Symbol DPY30 Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism eju  Eumetopias jubatus (Steller sea lion) Brite KEGG Orthology (KO) [BR:eju00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eju03036]     114219703 (DPY30) Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      114219703 (DPY30)     MLL-HCF complex      114219703 (DPY30)     MLL3/MLL4 complex      114219703 (DPY30) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 RIIa Motif Other DBs NCBI-GeneID:  114219703 NCBI-ProteinID:  XP_027973078 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MEPEQMLEGQTQVAENPHSEYGLTDNVERIVDNEKMNAEKSSKQKVDLQSLPTRAYLDQT VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggagccagagcagatgctggagggacagacgcaggttgcagaaaaccctcactctgag tacggtctcacagacaatgtcgagaggatagtagacaatgagaagatgaatgcagaaaag tcatcaaaacagaaagtggatctccagtctttgccaactcgtgcctacctggatcagaca gttgtgcctattttattacagggacttgctgtgcttgcaaaagaaagaccaccaaatccc attgaatttctagcatcatatcttttaaaaaacaaggcacagtttgaagatcgaaactga

DBGET integrated database retrieval system