Eumetopias jubatus (Steller sea lion): 114220476 Help Entry 114220476         CDS       T07240                                  Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju00480   Glutathione metabolism eju00980   Metabolism of xenobiotics by cytochrome P450 eju00982   Drug metabolism - cytochrome P450 eju00983   Drug metabolism - other enzymes eju01100   Metabolic pathways eju01524   Platinum drug resistance eju05200   Pathways in cancer eju05204   Chemical carcinogenesis - DNA adducts eju05215   Prostate cancer eju05225   Hepatocellular carcinoma eju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     114220476   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     114220476    00982 Drug metabolism - cytochrome P450     114220476    00983 Drug metabolism - other enzymes     114220476  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114220476    05204 Chemical carcinogenesis - DNA adducts     114220476   09162 Cancer: specific types    05225 Hepatocellular carcinoma     114220476    05215 Prostate cancer     114220476   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     114220476   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     114220476  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:eju02000]     114220476 Enzymes [BR:eju01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      114220476 Transporters [BR:eju02000]  Other transporters   Pores ion channels [TC:1]    114220476 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_N_3 GST_N_2 GST_C_2 Motif Other DBs NCBI-GeneID:  114220476 NCBI-ProteinID:  XP_027974181 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTKESWLQGPLKASCLYGQLPKFQDGD LTLYQSNAILRHLGRSLGLYGKDHREAALLDVVNDGVEDLRCKYVMLIYTNYEAGKEEYL KALPEYLKPFETLLSQNEGGQAFIVGNQISFTDYNLLDLLLIHQVLDPSCLDSLPLLSAY VMRLSARPKLKAFLASPEHVNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccattgtctactttcctgtgcgagggcgctgcgaggccatgcgcatg ctgctggctgaccagggccagagctggaaggaggaggtggtgaccaaggagagctggctg cagggcccgctcaaggcctcctgtctgtatgggcagctccccaagttccaggacggagac ctcaccctgtaccagtccaatgccatcctgcgacacctgggccgctcccttgggctgtac gggaaggaccatcgggaggcagccctgctggatgtggtgaacgatggtgtagaggacctt cgctgcaaatacgtcatgctcatctacactaactacgaggcagggaaggaggagtacctg aaggcactaccagagtacctgaagccctttgagacgctgttgtcccagaacgaggggggc caggccttcatcgtgggcaaccagatctccttcaccgactacaacctgctggacctgctg ctgattcaccaggtcctggaccccagctgcctggactccttgcccctgctctctgcctat gtgatgcgcctcagcgcccggcccaagctcaaggccttcctcgcctcccccgagcacgtg aaccgccccatcaacggcaacgggaaacaatga

DBGET integrated database retrieval system