Eumetopias jubatus (Steller sea lion): 114221021 Help Entry 114221021         CDS       T07240                                  Symbol UBB Name (RefSeq) polyubiquitin-B   KO K04551   ubiquitin B Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04120   Ubiquitin mediated proteolysis eju04137   Mitophagy - animal eju04140   Autophagy - animal eju05012   Parkinson disease eju05022   Pathways of neurodegeneration - multiple diseases eju05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:eju00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114221021 (UBB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114221021 (UBB)    04137 Mitophagy - animal     114221021 (UBB)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     114221021 (UBB)   09164 Neurodegenerative disease    05012 Parkinson disease     114221021 (UBB)    05022 Pathways of neurodegeneration - multiple diseases     114221021 (UBB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:eju04121]     114221021 (UBB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eju04147]     114221021 (UBB) Ubiquitin system [BR:eju04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    114221021 (UBB) Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of breast milk    114221021 (UBB)   Exosomal proteins of other body fluids (saliva and urine)    114221021 (UBB)   Exosomal proteins of colorectal cancer cells    114221021 (UBB)   Exosomal proteins of bladder cancer cells    114221021 (UBB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2604 TBK1_ULD Ubiquitin_5 Dsc3_N HATPase_c UBL_UBAC1 FlgD_ig Motif Other DBs NCBI-GeneID:  114221021 NCBI-ProteinID:  XP_027974934 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MQIFVKTLTGKTINLEVEPSDTIKNVKAKIQDKEGIPPDQQRLIFAGKQLEDGHTLSDYN IQKESTLHLVLRLRGGMQIFMKTLTGKTITLEVEPSDTIENVKVKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctgaccggcaagaccatcaacctagaggtagagcctagt gacaccatcaaaaatgtgaaggccaagatccaagataaagagggtatcccccctgaccag cagaggctcatttttgcaggcaagcagctggaagatggccacactctttctgattataac atccagaaagagtcgaccctgcacctggttctgcgcctgaggggtggcatgcagatcttc atgaagaccctaactgggaagaccatcaccctggaggtggagcccagtgataccattgaa aacgtgaaggtgaagatccaagataaagagggcatcccccctgaccagcagaggctcatt tttgctggcaagcagctggaagatggccgcactctttctgattacaatatccagaaagag tcaactctccacctggttctccgtctgaggggtggctgttaa

DBGET integrated database retrieval system