Eumetopias jubatus (Steller sea lion): 114221180 Help Entry 114221180         CDS       T07240                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04613   Neutrophil extracellular trap formation eju05034   Alcoholism eju05202   Transcriptional misregulation in cancer eju05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:eju00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114221180  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     114221180   09163 Immune disease    05322 Systemic lupus erythematosus     114221180   09165 Substance dependence    05034 Alcoholism     114221180  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eju03036]     114221180   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eju04147]     114221180 Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114221180 Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114221180 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  114221180 NCBI-ProteinID:  XP_027975123 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MGDQEQQSSVMPQVLAGSWGQNWQKAQTAGKSTGGKAPRMQLATKAALKSAPSTGGVKKP RRYRPGTRLVREIAQDFKTDLRFKSGSYWCLAGGKRVLFWWASEDTSLCTIQGKRVTIMP EDIQLARRILAERA NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgggagaccaagagcagcaatcctcagtgatgcctcaggtccttgccggctcctggggg cagaattggcagaaagcacagactgccggcaaatcgaccgggggtaaagcaccgagaatg caactggctacaaaagccgccctcaagagtgcgccctctactggaggggtgaagaaacct cgtcgttaccggcctgggacgcgtctggtgcgagaaattgcccaggacttcaaaacagat ctgcgcttcaagagcggcagctattggtgcttggcaggaggcaagcgagtcctcttctgg tgggcctctgaagacaccagcctgtgcactatccaaggcaaacgtgtcacaattatgcca gaagacatccagctagcgcgccgcatacttgcagaacgtgcttaa

DBGET integrated database retrieval system