Eumetopias jubatus (Steller sea lion): 114223261 Help Entry 114223261         CDS       T07240                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju03010   Ribosome eju04120   Ubiquitin mediated proteolysis eju04137   Mitophagy - animal eju04140   Autophagy - animal eju05012   Parkinson disease eju05022   Pathways of neurodegeneration - multiple diseases eju05167   Kaposi sarcoma-associated herpesvirus infection eju05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:eju00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     114223261   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114223261  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114223261    04137 Mitophagy - animal     114223261  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     114223261    05167 Kaposi sarcoma-associated herpesvirus infection     114223261   09164 Neurodegenerative disease    05012 Parkinson disease     114223261    05022 Pathways of neurodegeneration - multiple diseases     114223261  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:eju03011]     114223261    04121 Ubiquitin system [BR:eju04121]     114223261 Ribosome [BR:eju03011]  Ribosomal proteins   Eukaryotes    Large subunit     114223261   Archaea     114223261 Ubiquitin system [BR:eju04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    114223261 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 OTU1_UBXL DUF2604 Motif Other DBs NCBI-GeneID:  114223261 NCBI-ProteinID:  XP_027977920 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRPIFAGKQLEDGRALSDYN IQEESTLNLVLRLQGGIIEASLHQLTQKYNCDKMICRKCYARLHPRAVNCRKKCSHPNNL RPKKKVK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagaccctgacaggcaagaccatcaccctcgaggtcgagcccagt gacactattgagaatgtcaaagccaaaatccaagacaaggagggcatcccgcctgaccag cagcgtccgatttttgcgggcaaacagctggaagatggccgtgctctgtcagactataat atccaggaagagtccaccctgaacttggtgcttcgcctccagggtggcatcatcgaggct tccctccaccagctgacccagaaatacaactgtgacaagatgatctgccgcaagtgttac gctcgcctgcacccccgtgctgtcaactgccgcaagaagtgcagccaccccaacaacctg cgccccaaaaagaaggtcaaataa

DBGET integrated database retrieval system