Eumetopias jubatus (Steller sea lion): 114223488 Help Entry 114223488         CDS       T07240                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04010   MAPK signaling pathway eju04060   Cytokine-cytokine receptor interaction eju04217   Necroptosis eju04218   Cellular senescence eju04380   Osteoclast differentiation eju04640   Hematopoietic cell lineage eju04932   Non-alcoholic fatty liver disease eju04933   AGE-RAGE signaling pathway in diabetic complications eju04940   Type I diabetes mellitus eju05010   Alzheimer disease eju05020   Prion disease eju05022   Pathways of neurodegeneration - multiple diseases eju05133   Pertussis eju05140   Leishmaniasis eju05152   Tuberculosis eju05162   Measles eju05164   Influenza A eju05321   Inflammatory bowel disease eju05323   Rheumatoid arthritis eju05332   Graft-versus-host disease eju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114223488 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114223488 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     114223488 (IL1A)    04218 Cellular senescence     114223488 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     114223488 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     114223488 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     114223488 (IL1A)    05162 Measles     114223488 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     114223488 (IL1A)    05152 Tuberculosis     114223488 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     114223488 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     114223488 (IL1A)    05321 Inflammatory bowel disease     114223488 (IL1A)    05332 Graft-versus-host disease     114223488 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     114223488 (IL1A)    05020 Prion disease     114223488 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     114223488 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     114223488 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     114223488 (IL1A)    04932 Non-alcoholic fatty liver disease     114223488 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     114223488 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114223488 (IL1A) Cytokines and neuropeptides [BR:eju04052]  Cytokines   Interleukins    114223488 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep CAF1-p150_C2 DNA_pol_alpha_N Motif Other DBs NCBI-GeneID:  114223488 NCBI-ProteinID:  XP_027978250 LinkDB All DBs Position Unknown AA seq 265 aa AA seqDB search MAKVPDLFEDLKNCYSENEEYSSEIDHLSLNQKSFYDVSYDPLYEDCMSLSTSKTSKTSQ LTFKENVVVVAANGKVLKKRRLSLNQFITDDDLDGFTNDAEEEIMKPRSVAYNFHSNEKY NYMRIIKSQFILNDNLNQSIIQQTGGNYLMAAALQNLEDAAKFDMGAYTSEDSKLPVTLR ISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGTKNYFTSVAQPKLFIAT QERKLVHMARGQPSITDFQILETQP NT seq 798 nt NT seq  +upstreamnt  +downstreamnt atggccaaagttcccgacctttttgaagacctgaagaattgttacagtgaaaatgaagaa tacagttctgaaattgaccatctctctctgaatcagaaatccttctatgatgtgagctat gacccactttatgaggactgcatgtctctgagtacctccaaaacctcaaagacatctcag cttaccttcaaggagaatgtggtggtggtggcagccaatgggaaagttctgaagaagaga cggttgagtttaaatcaattcatcactgatgatgacctggatggctttaccaatgatgca gaagaagaaatcatgaagcccagatcagtagcatacaacttccacagcaatgaaaaatac aactatatgaggatcatcaaatcccagttcatcctgaatgacaacctcaatcaaagtata attcaacaaacagggggaaattacctcatggctgctgcattgcagaatctggaagatgca gcgaaatttgacatgggcgcttatacatcagaagattctaaacttcctgtgactctaaga atctcaaaaactagactatttgtgagtgcccaaaatgaagatgaacctgtactgctaaag gagatgcctgagacacccaaaaccatcagagatgagaccaaccttctcttcttctgggaa cgtcatggcactaagaactacttcacatcagttgcccagccaaagttgttcattgccaca caagaacgaaaactggtgcacatggcaagagggcaaccctctatcactgactttcagata ctggaaacccagccttga

DBGET integrated database retrieval system