Eumetopias jubatus (Steller sea lion): 114224061 Help Entry 114224061         CDS       T07240                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism eju  Eumetopias jubatus (Steller sea lion) Brite KEGG Orthology (KO) [BR:eju00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:eju03041]     114224061   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114224061 Spliceosome [BR:eju03041]  Complex B   Other components    Complex B specific factors     114224061 Cytokines and neuropeptides [BR:eju04052]  Neuropeptides   Unclassified    114224061 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  114224061 NCBI-ProteinID:  XP_027978898 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDHLGKKVRVKCNTDDTIGDLKKLIAAQTGTLWNKIILKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccatctagggaagaaggtccgcgttaagtgcaacact gatgacaccatcggggaccttaagaagctgatcgcagcccaaactggcaccctttggaac aagatcatcctgaagaagtggtacacgatttttaaggaccatgtgtctctgggggactat gaaatccatgatgggatgaacctggagctttattaccaatag

DBGET integrated database retrieval system