Eumetopias jubatus (Steller sea lion): 114225106 Help Entry 114225106         CDS       T07240                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04014   Ras signaling pathway eju04015   Rap1 signaling pathway eju04022   cGMP-PKG signaling pathway eju04024   cAMP signaling pathway eju04062   Chemokine signaling pathway eju04071   Sphingolipid signaling pathway eju04072   Phospholipase D signaling pathway eju04081   Hormone signaling eju04144   Endocytosis eju04150   mTOR signaling pathway eju04270   Vascular smooth muscle contraction eju04310   Wnt signaling pathway eju04350   TGF-beta signaling pathway eju04360   Axon guidance eju04510   Focal adhesion eju04517   IgSF CAM signaling eju04520   Adherens junction eju04530   Tight junction eju04611   Platelet activation eju04621   NOD-like receptor signaling pathway eju04625   C-type lectin receptor signaling pathway eju04660   T cell receptor signaling pathway eju04670   Leukocyte transendothelial migration eju04722   Neurotrophin signaling pathway eju04810   Regulation of actin cytoskeleton eju04921   Oxytocin signaling pathway eju04928   Parathyroid hormone synthesis, secretion and action eju04972   Pancreatic secretion eju05100   Bacterial invasion of epithelial cells eju05132   Salmonella infection eju05133   Pertussis eju05135   Yersinia infection eju05152   Tuberculosis eju05163   Human cytomegalovirus infection eju05200   Pathways in cancer eju05203   Viral carcinogenesis eju05205   Proteoglycans in cancer eju05206   MicroRNAs in cancer eju05210   Colorectal cancer eju05417   Lipid and atherosclerosis eju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     114225106 (RHOA)    04015 Rap1 signaling pathway     114225106 (RHOA)    04310 Wnt signaling pathway     114225106 (RHOA)    04350 TGF-beta signaling pathway     114225106 (RHOA)    04072 Phospholipase D signaling pathway     114225106 (RHOA)    04071 Sphingolipid signaling pathway     114225106 (RHOA)    04024 cAMP signaling pathway     114225106 (RHOA)    04022 cGMP-PKG signaling pathway     114225106 (RHOA)    04150 mTOR signaling pathway     114225106 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     114225106 (RHOA)    04517 IgSF CAM signaling     114225106 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114225106 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     114225106 (RHOA)    04520 Adherens junction     114225106 (RHOA)    04530 Tight junction     114225106 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     114225106 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     114225106 (RHOA)    04621 NOD-like receptor signaling pathway     114225106 (RHOA)    04625 C-type lectin receptor signaling pathway     114225106 (RHOA)    04660 T cell receptor signaling pathway     114225106 (RHOA)    04670 Leukocyte transendothelial migration     114225106 (RHOA)    04062 Chemokine signaling pathway     114225106 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     114225106 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     114225106 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     114225106 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     114225106 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     114225106 (RHOA)   09158 Development and regeneration    04360 Axon guidance     114225106 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114225106 (RHOA)    05206 MicroRNAs in cancer     114225106 (RHOA)    05205 Proteoglycans in cancer     114225106 (RHOA)    05203 Viral carcinogenesis     114225106 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     114225106 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     114225106 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     114225106 (RHOA)    05135 Yersinia infection     114225106 (RHOA)    05133 Pertussis     114225106 (RHOA)    05152 Tuberculosis     114225106 (RHOA)    05100 Bacterial invasion of epithelial cells     114225106 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114225106 (RHOA)    05418 Fluid shear stress and atherosclerosis     114225106 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eju04131]     114225106 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eju04147]     114225106 (RHOA)    04031 GTP-binding proteins [BR:eju04031]     114225106 (RHOA) Membrane trafficking [BR:eju04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     114225106 (RHOA) Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114225106 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    114225106 (RHOA)   Exosomal proteins of colorectal cancer cells    114225106 (RHOA)   Exosomal proteins of bladder cancer cells    114225106 (RHOA) GTP-binding proteins [BR:eju04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     114225106 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  114225106 NCBI-ProteinID:  XP_027980331 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt ttgctcatcgtctttagcaaggaccagttcccagaagtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggacc ccggaagtcaagcacttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa ccggaagaaggcagagatatggcaaacaggattggcgctttcggttacatggagtgttca gcaaagaccaaagatggagtgagggaagtttttgaaatggccacaagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system