Eumetopias jubatus (Steller sea lion): 114225262 Help Entry 114225262         CDS       T07240                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04015   Rap1 signaling pathway eju04810   Regulation of actin cytoskeleton eju05014   Amyotrophic lateral sclerosis eju05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     114225262 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     114225262 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114225262 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     114225262 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eju04131]     114225262 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:eju04812]     114225262 (PFN1)    04147 Exosome [BR:eju04147]     114225262 (PFN1) Membrane trafficking [BR:eju04131]  Others   Actin-binding proteins    Others     114225262 (PFN1) Cytoskeleton proteins [BR:eju04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      114225262 (PFN1) Exosome [BR:eju04147]  Exosomal proteins   Proteins found in most exosomes    114225262 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  114225262 NCBI-ProteinID:  XP_027980613 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaacgggctgacacttgggggccagaaatgttctgttatccgggactcactgctgcag gatggggaatttaccatggatcttcgtaccaagagcaccgggggagcccccactttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggaggtatgatcaacaagaaatgctacgaaatggcctctcacctgcggcgttcccagtac tga

DBGET integrated database retrieval system