Enterobacter kobei DSM 13645: BFV64_01735 Help Entry BFV64_01735       CDS       T04686                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ekb  Enterobacter kobei DSM 13645 Pathway ekb02024   Quorum sensing ekb03018   RNA degradation Brite KEGG Orthology (KO) [BR:ekb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BFV64_01735  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BFV64_01735  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ekb03019]     BFV64_01735    03036 Chromosome and associated proteins [BR:ekb03036]     BFV64_01735 Messenger RNA biogenesis [BR:ekb03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BFV64_01735 Chromosome and associated proteins [BR:ekb03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BFV64_01735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  AOP85149 UniProt:  A0A0F0YAV3 LinkDB All DBs Position 360340..360651 Genome browser AA seq 103 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGTGSNYHHGSNAQGSSTPAQDSDETE NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcctgaacgcattgcgtcgggaacgtgtt ccagtttctatttatttggtgaatggtattaagctgcaaggtcagattgagtctttcgat cagtttgtgatcctgttgaaaaacacggtcagtcagatggtctacaagcacgctatctct actgttgttccgtcccgtccagtctctcatcacagcaataacgctggcggcggcactggc agtaactaccatcatggcagcaacgcgcagggttcttcaacgccagcgcaggacagcgac gaaaccgaataa

DBGET integrated database retrieval system