Enterobacter kobei DSM 13645: BFV64_02840 Help Entry BFV64_02840       CDS       T04686                                  Name (GenBank) DNA polymerase III subunit psi   KO K02344   DNA polymerase III subunit psi [EC:2.7.7.7] Organism ekb  Enterobacter kobei DSM 13645 Pathway ekb03030   DNA replication ekb03430   Mismatch repair ekb03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ekb00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     BFV64_02840    03430 Mismatch repair     BFV64_02840    03440 Homologous recombination     BFV64_02840  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ekb03032]     BFV64_02840    03400 DNA repair and recombination proteins [BR:ekb03400]     BFV64_02840 Enzymes [BR:ekb01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      BFV64_02840 DNA replication proteins [BR:ekb03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      BFV64_02840 DNA repair and recombination proteins [BR:ekb03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      BFV64_02840 SSDB OrthologParalogGFIT Motif Pfam:  DNA_III_psi CSTF_C Inhibitor_I66 Motif Other DBs NCBI-ProteinID:  AOP85355 UniProt:  A0A0P8LAY8 LinkDB All DBs Position 585854..586267 Genome browser AA seq 137 aa AA seqDB search MTSRRDWQLQQLGITQWALRRPTALQGEIAISIPAHVRLVMVAEELPALNEPLIGDVLRS LKLTSDQVLQLTPERVAMLPPESRCNSWRIGETTDISLQGSQICSPALDELKANPKARSA LWQQICEYEHDFFPHDA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgacatcccgacgagactggcagttgcagcagctgggcatcacccagtgggccttgcgt cgcccgacggcgttgcagggcgaaatcgctatctccatcccggcgcacgtcaggctggtg atggtggcggaagaactgcctgccctgaatgaacccctgattggtgatgtccttcgcagc ctgaagctgacttccgaccaggttttacagctgacgccggaacgggtggcaatgcttcct cctgagagtcggtgtaacagctggcgcatcggagagacgaccgacatctctcttcagggg agccagatctgctcgccagcgctggacgaactgaaagccaacccaaaagcgcgcagcgcg ctatggcaacaaatctgcgaatatgaacacgatttcttccctcacgacgcctga

DBGET integrated database retrieval system