Enterobacter kobei DSM 13645: BFV64_04965 Help Entry BFV64_04965       CDS       T04686                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism ekb  Enterobacter kobei DSM 13645 Brite KEGG Orthology (KO) [BR:ekb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ekb03032]     BFV64_04965    03036 Chromosome and associated proteins [BR:ekb03036]     BFV64_04965    03400 DNA repair and recombination proteins [BR:ekb03400]     BFV64_04965 DNA replication proteins [BR:ekb03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BFV64_04965 Chromosome and associated proteins [BR:ekb03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BFV64_04965 DNA repair and recombination proteins [BR:ekb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BFV64_04965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AOP85749 UniProt:  A0A0F0Y4Z3 LinkDB All DBs Position 1053215..1053487 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDALIASVTESLQAGDDVALVGFGTFAVKERAARTG RNPQTGKEITIAAAKVPGFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatctcaactgattgacaaaattgctgctggtgctgatatttctaaagctgca gctggacgtgcgttagatgcattaattgcttctgttactgaatctctgcaggctggagac gacgttgcactggtaggcttcggtacttttgctgttaaagagcgtgctgcccgtactggc cgcaaccctcagaccggtaaagagatcaccattgctgctgctaaagtgccgggtttccgt gcaggtaaagcgctgaaagacgcagtaaattga

DBGET integrated database retrieval system