Enterobacter kobei DSM 13645: BFV64_08360 Help Entry BFV64_08360       CDS       T04686                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism ekb  Enterobacter kobei DSM 13645 Brite KEGG Orthology (KO) [BR:ekb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ekb03400]     BFV64_08360 DNA repair and recombination proteins [BR:ekb03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     BFV64_08360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI KH_PARP14_2 DUF2397 Motif Other DBs NCBI-ProteinID:  AOP86364 UniProt:  A0A2J0PMC8 LinkDB All DBs Position complement(1748641..1748886) Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTTVLPAGALDALAGELSRRIHNTFPDNAGAVTVRYAAANNLSVIGGAKEDK DRISEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgaagtcaccatagccaaaactaccgttctgcctgctggcgcgcttgacgca ctggcaggcgaattatcccgtcgtattcataacaccttccccgacaatgcaggcgccgtc actgttcgttacgccgcggcgaacaacctttccgtcattggcggtgcaaaagaagataaa gatcgcatcagcgaaatcctgcaggaaacgtgggagagcgcggacgactggttcatcaca gattaa

DBGET integrated database retrieval system