Enterobacter kobei DSM 13645: BFV64_08530 Help Entry BFV64_08530       CDS       T04686                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ekb  Enterobacter kobei DSM 13645 Pathway ekb01100   Metabolic pathways ekb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ekb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BFV64_08530    00074 Mycolic acid biosynthesis     BFV64_08530   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BFV64_08530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  AOP86398 UniProt:  A0A0F0XVF7 LinkDB All DBs Position 1781400..1781636 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system