Enterobacter kobei DSM 13645: BFV64_15635
Help
Entry
BFV64_15635 CDS
T04686
Name
(GenBank) NADH-quinone oxidoreductase subunit M
KO
K00342
NADH-quinone oxidoreductase subunit M [EC:
7.1.1.2
]
Organism
ekb
Enterobacter kobei DSM 13645
Pathway
ekb00190
Oxidative phosphorylation
ekb01100
Metabolic pathways
Module
ekb_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
ekb00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
BFV64_15635
Enzymes [BR:
ekb01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
BFV64_15635
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Proton_antipo_M
Proton_antipo_N
Motif
Other DBs
NCBI-ProteinID:
AOP87705
UniProt:
A0A0P8IL64
LinkDB
All DBs
Position
complement(3260631..3262160)
Genome browser
AA seq
509 aa
AA seq
DB search
MLLPWLILIPFIGGFLCWQTERFGVKMPRWIALITMGLTLALGLQLWLQGGYSLTQSAGI
PQWQSEFILPWIPRFGITIHLAIDGLSLLMVVLTGLLGVLAVLCSWREIEKYQGFFHLNL
MWILGGVIGVFLAIDMFLFFFFWEMMLVPMYFLIALWGHKASDGKTRITAATKFFIYTQA
SGLVMLIAILALVFVHHNATGIWTFNYEDLLKTPMSHGVEYLLMLGFFIAFAVKMPVVPL
HGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFALPLFPNASAEFAPIAMWLGVIGIFY
GAWMAFTQYDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQGAVIQMIAHGLSAAGLFILCG
QLYERLHTRDMRMMGGLWSKIKWLPALSMFFAVATLGMPGTGNFVGEFMILFGSFKVVPV
ITVISTFGLVFASVYSLAMLHRAYFGKAKSEIAAQELPGMSLRELFIILLLVVLLVLLGF
FPQPILDTSHSAMGNIQQWFVNSASTTRP
NT seq
1530 nt
NT seq
+upstream
nt +downstream
nt
atgttactaccctggctaatattaattcccttcatcggcggcttcctgtgctggcagact
gaacgctttggcgtgaagatgccgcgctggatcgcgctgatcaccatgggattgacgctc
gcgcttggcctgcaactgtggttgcagggcggttactcactgacccagtctgcgggcatc
ccgcagtggcagtctgagttcatcctgccttggatcccacgtttcggtatcaccatccac
ctggcgattgacggtctgtcgctgctgatggtggtgctgaccggtctgctcggtgttctg
gcggtactctgctcctggcgagaaatcgaaaaataccagggctttttccacctgaacctg
atgtggatcctgggcggcgtgatcggcgtgttccttgccatcgacatgttcctgttcttc
ttcttctgggagatgatgctggtgccgatgtacttcctgatcgcgctgtggggccacaag
gcatccgacggtaaaacgcgtatcacggcggcgaccaagttcttcatctacacccaggcg
agcggtctggtgatgttgattgccattctggcactggtgtttgttcaccataacgcaacg
ggcatctggaccttcaactacgaagatctgctgaaaaccccgatgtcacacggcgttgaa
tacctgctgatgctgggcttcttcatcgcattcgcggtgaaaatgccggtggttccgctg
cacggctggctgccagacgcgcactctcaggcacccactgcgggttccgttgacctggcg
ggcatcttgctgaaaaccgcggcctacggtctgctgcgcttcgcgctgccgctgttcccg
aatgcgtccgctgagtttgccccgattgccatgtggctcggtgtgatcggtatcttctac
ggtgcctggatggccttcacgcagtacgacatcaagcgtctgattgcctacacctccgtt
tcccacatgggcttcgtgctgattgccatctacaccggcagccagctggcgtaccagggc
gcggtgatccagatgattgcgcacggtctgtccgctgccggcctcttcatcctgtgtggt
cagctgtacgaacgtctgcacacgcgtgacatgcgcatgatgggcggtctgtggagcaaa
attaaatggctgccagcgctctccatgttcttcgcggttgccaccctggggatgccaggc
accggtaacttcgtcggcgaatttatgattctgttcggcagcttcaaagtggtgccggtg
atcaccgtgatctccacctttggtctggtgttcgcttccgtctactcgctggcgatgctg
caccgcgcttacttcggtaaagcgaagagcgaaattgctgcacaagaactgccggggatg
tcgctgcgtgagctgttcatcatcctgctgctggtcgtactgctggtgctgctgggcttc
ttcccgcagccgattctggatacctcgcacagtgcgatgggcaacatccagcagtggttt
gttaattctgcttctactacaaggccgtaa
DBGET
integrated database retrieval system