Enterobacter kobei DSM 13645: BFV64_17285 Help Entry BFV64_17285       CDS       T04686                                  Name (GenBank) damage-inducible protein DinI   KO K12149   DNA-damage-inducible protein I Organism ekb  Enterobacter kobei DSM 13645 Brite KEGG Orthology (KO) [BR:ekb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ekb03400]     BFV64_17285 DNA repair and recombination proteins [BR:ekb03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     BFV64_17285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Rnk_N DUF1376 DUF6305 HTH_25 Motif Other DBs NCBI-ProteinID:  AOP87999 LinkDB All DBs Position complement(3598017..3598250) Genome browser AA seq 77 aa AA seqDB search MRIEIMIDKEQKISQATLEALESELYRNLHPLYPKTAIRIRKGSANGLELSGLKLDEDKK RVMEILQQVWEDDSWLH NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcgcattgaaataatgatcgataaagagcagaagataagccaggcaacactggaagcc cttgaatccgagctttaccgaaatttgcaccctctctatccaaaaacggcaatccgcata cgtaagggaagcgctaacggcctggagctgagcggcttaaaactggacgaagataaaaag cgggtaatggagattttacagcaggtctgggaggacgatagctggttgcactaa

DBGET integrated database retrieval system