Epidermidibacterium keratini: EK0264_03375 Help Entry EK0264_03375      CDS       T06370                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eke  Epidermidibacterium keratini Pathway eke01100   Metabolic pathways eke01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eke00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EK0264_03375    00074 Mycolic acid biosynthesis     EK0264_03375   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EK0264_03375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QHB99416 UniProt:  A0A7L4YLI5 LinkDB All DBs Position complement(695137..695379) Genome browser AA seq 80 aa AA seqDB search MAAITADQVKNDVAEYLQLDRDKLTEYALLTEDLGVDSLTAIEMSIQLEGSYGIDISDEE LAEVSTYGDLERLVLSKNEE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggccgccatcaccgccgaccaggtcaaaaacgacgtcgctgaatatctgcaactcgat cgcgacaagctcaccgagtacgcgttgctcaccgaggacctcggggtcgactcgctcacc gccatcgagatgtccattcagcttgagggcagctacggcatcgacatctccgacgaggag ctcgccgaggtgtcgacgtacggcgatcttgagcgcctcgtgctcagcaagaacgaggag tag

DBGET integrated database retrieval system