Escherichia coli KO11FL: KO11_17005 Help Entry KO11_17005        CDS       T02104                                  Name (GenBank) hypothetical protein   KO K21976   probable RcsB/C two-component-system connector, global regulator of biofilm formation and acid-resistance Organism ekf  Escherichia coli KO11FL Brite KEGG Orthology (KO) [BR:ekf00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99995 Signaling proteins     KO11_17005 SSDB OrthologParalogGFIT Motif Pfam:  YmgB Motif Other DBs NCBI-ProteinID:  AFH18370 LinkDB All DBs Position complement(3579178..3579444) Genome browser AA seq 88 aa AA seqDB search MLEDTTIHNAITDKALASYFRSSGNLLEEESAVLGQAVTNLMLSGDNVNNKNIILSLIHS LETTSDILKADVIRKTLEIVLRYTADDM NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcttgaagatactacaattcataatgcaataactgataaagcgttagcaagttacttt cgcagttcgggtaatttgttagaagaagagtcagcagtgttagggcaggctgtcaccaat ttaatgctttcaggcgataatgttaataataaaaatattatcttaagtctgatacactcc ctggaaacaacaagtgatattctcaaagctgatgtgattagaaaaacactggaaatcgtg ttgcgatacacagctgatgatatgtaa

DBGET integrated database retrieval system