Escherichia coli KO11FL: KO11_17250 Help Entry KO11_17250        CDS       T02104                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ekf  Escherichia coli KO11FL Pathway ekf01100   Metabolic pathways ekf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ekf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KO11_17250    00074 Mycolic acid biosynthesis     KO11_17250   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KO11_17250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AFH18419 LinkDB All DBs Position complement(3628863..3629099) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system