Escherichia coli KO11FL: KO11_22375 Help Entry KO11_22375        CDS       T02104                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism ekf  Escherichia coli KO11FL Pathway ekf02020   Two-component system ekf02026   Biofilm formation - Escherichia coli ekf02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ekf00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     KO11_22375  09140 Cellular Processes   09145 Cellular community - prokaryotes    02026 Biofilm formation - Escherichia coli     KO11_22375   09142 Cell motility    02040 Flagellar assembly     KO11_22375  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ekf02035]     KO11_22375 Bacterial motility proteins [BR:ekf02035]  Flagellar system   Flagellar assembly proteins    Others     KO11_22375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM SP_0191-like Motif Other DBs NCBI-ProteinID:  AFH19435 LinkDB All DBs Position 4752352..4752630 Genome browser AA seq 92 aa AA seqDB search MKITPTMPGNRPTATTAGSNQPRKTTATTTTTLSADDITQAGLQSAQQTLNDQQESDIDS DKVAQMQAMLASGSLQVDTEQLASDMLSFFQN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaaatcaccccgactatgccaggcaatcgcccgacagccacgacggcaggctccaac cagccgcgcaaaaccacggcgaccaccaccacgacgctgagcgccgacgacattactcag gcgggattgcagtccgcccagcaaacgctgaacgaccagcaagagagcgatatcgacagc gacaaagtggcgcaaatgcaggcgatgctggcctccggcagcctgcaagtggacaccgaa cagttagccagcgacatgctgagttttttccagaactaa

DBGET integrated database retrieval system