Escherichia coli KO11FL: KO11_22485 Help Entry KO11_22485        CDS       T02104                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism ekf  Escherichia coli KO11FL Pathway ekf02024   Quorum sensing ekf03018   RNA degradation Brite KEGG Orthology (KO) [BR:ekf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     KO11_22485 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     KO11_22485 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ekf03019]     KO11_22485 (hfq)    03036 Chromosome and associated proteins [BR:ekf03036]     KO11_22485 (hfq) Messenger RNA biogenesis [BR:ekf03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      KO11_22485 (hfq) Chromosome and associated proteins [BR:ekf03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     KO11_22485 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AFH19457 LinkDB All DBs Position 4777023..4777331 Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcctgaacgcactgcgtcgggaacgtgtt ccagtttctatttatttggtgaatggtattaagctgcaagggcaaatcgagtcttttgat cagttcgtgatcctgttgaaaaacacggtcagccagatggtttacaagcacgcgatttct actgttgtcccgtctcgtccggtttctcatcacagtaacaacgccggtggcggtaccagc agtaactaccatcatggtagcagcgcgcagaatacttccgcgcaacaggacagcgaagaa accgaataa

DBGET integrated database retrieval system